(data stored in ACNUC7421 zone)

EMBL: CP001111.PE137

CP001111.PE137       Location/Qualifiers
FT   CDS             complement(176166..176642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0137"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cel:F09E10.7 F09E10.7a"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49842"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSG0"
FT                   /protein_id="ACF49842.1"
FT                   /translation="MRRTRLAVIFCSALLLAIPAIAHDAESTKAAQPLPDAALPATLDR
FT                   VLRDYEQAWRSGDAKALAALFAEDGFVLQSSQLPVRGRSAIEAAYSGQGGSPLRLRALA
FT                   YSVDGNTGYIIGAYRYGNNMGDTGKFTLTLKRVGDGPWLIFSDMDNGNAPPRAR"
     MRRTRLAVIF CSALLLAIPA IAHDAESTKA AQPLPDAALP ATLDRVLRDY EQAWRSGDAK        60
     ALAALFAEDG FVLQSSQLPV RGRSAIEAAY SGQGGSPLRL RALAYSVDGN TGYIIGAYRY       120
     GNNMGDTGKF TLTLKRVGDG PWLIFSDMDN GNAPPRAR                               158
//

If you have problems or comments...

PBIL Back to PBIL home page