(data stored in ACNUC7421 zone)

EMBL: CP001111.PE138

CP001111.PE138       Location/Qualifiers
FT   CDS             176759..177427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0138"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ssc:733643 nuclear receptor corepressor 2"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49843"
FT                   /db_xref="InterPro:IPR036501"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSG1"
FT                   /protein_id="ACF49843.1"
FT                   /translation="MKIRITGMVLTVALLAACGQEPAPDAAAPAAPAPATEAPAATATV
FT                   VEKEPPIEDGVDPSVWDNEGEPEDPSAGGELTCADNPLATHFFTLVGGNTVDDCGRKDP
FT                   KVLAAFNALMKNTAAAESADKEIPSLRERLLSGPSGPGELVVLQGEPWWFYTACQAHDC
FT                   PGTALAMLYSPDQSKMVGRLTARCRIWWLGEPSDEQRALIEREQPVDKEMLKEEGESCE
FT                   "
     MKIRITGMVL TVALLAACGQ EPAPDAAAPA APAPATEAPA ATATVVEKEP PIEDGVDPSV        60
     WDNEGEPEDP SAGGELTCAD NPLATHFFTL VGGNTVDDCG RKDPKVLAAF NALMKNTAAA       120
     ESADKEIPSL RERLLSGPSG PGELVVLQGE PWWFYTACQA HDCPGTALAM LYSPDQSKMV       180
     GRLTARCRIW WLGEPSDEQR ALIEREQPVD KEMLKEEGES CE                          222
//

If you have problems or comments...

PBIL Back to PBIL home page