(data stored in ACNUC7421 zone)

EMBL: CP001111.PE14

CP001111.PE14        Location/Qualifiers
FT   CDS             15201..15944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0014"
FT                   /product="Pyridoxal phosphate biosynthetic protein PdxJ"
FT                   /note="PFAM: Pyridoxal phosphate biosynthetic protein PdxJ;
FT                   KEGG: xcb:XC_0012 pyridoxal phosphate biosynthetic protein
FT                   PdxJ"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49719"
FT                   /db_xref="GOA:B4SR18"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR18"
FT                   /protein_id="ACF49719.1"
FT                   /translation="MTQLSVNVNKIAVLRNSRGGAEPDVVRAAQACLDAGAHGITVHPR
FT                   PDRRHITAEDVLALSTLTRARGVEFNIEGNPFAPPREGYPGLLPLCAQTRPAQATLVPD
FT                   SDGQITSDHGFDFERDAERLRPLIAELKAMGCRVSLFVDAGNPLLEQAAEVGADRIELY
FT                   TGPYAEAHAAGDAGAMLTLFATAARRAQAVGLGVNAGHDLSQDNLRDFLANVPDVLEVS
FT                   IGHALIGEALYDGLDATVRGYLALL"
     MTQLSVNVNK IAVLRNSRGG AEPDVVRAAQ ACLDAGAHGI TVHPRPDRRH ITAEDVLALS        60
     TLTRARGVEF NIEGNPFAPP REGYPGLLPL CAQTRPAQAT LVPDSDGQIT SDHGFDFERD       120
     AERLRPLIAE LKAMGCRVSL FVDAGNPLLE QAAEVGADRI ELYTGPYAEA HAAGDAGAML       180
     TLFATAARRA QAVGLGVNAG HDLSQDNLRD FLANVPDVLE VSIGHALIGE ALYDGLDATV       240
     RGYLALL                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page