(data stored in ACNUC7421 zone)

EMBL: CP001111.PE141

CP001111.PE141       Location/Qualifiers
FT   CDS             complement(179540..180226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cak:Caul_4105 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49846"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSG4"
FT                   /protein_id="ACF49846.1"
FT                   /translation="MALAVACSGVANARDKDAPAPPVATVDELPADQSVSETVIELAGW
FT                   VVASKDNQGYPFAIMDKAAAQVLVFSGDGKLRGAAPALFGSAIGDHSAPGVAKLALSAI
FT                   PGHDRTTPAGRFIGGYGPSDDAGRVLWVDYDSAVSMHPLPPGTPKEKRAQRLASPSPDD
FT                   NRVTHGCINVTPAFYEQIVQSTFEKGGVFYILPDKDSIAKTFPEFAQSRGDAKDEDEKG
FT                   ARRASK"
     MALAVACSGV ANARDKDAPA PPVATVDELP ADQSVSETVI ELAGWVVASK DNQGYPFAIM        60
     DKAAAQVLVF SGDGKLRGAA PALFGSAIGD HSAPGVAKLA LSAIPGHDRT TPAGRFIGGY       120
     GPSDDAGRVL WVDYDSAVSM HPLPPGTPKE KRAQRLASPS PDDNRVTHGC INVTPAFYEQ       180
     IVQSTFEKGG VFYILPDKDS IAKTFPEFAQ SRGDAKDEDE KGARRASK                    228
//

If you have problems or comments...

PBIL Back to PBIL home page