(data stored in ACNUC7421 zone)

EMBL: CP001111.PE143

CP001111.PE143       Location/Qualifiers
FT   CDS             complement(180868..181863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swi:Swit_2733 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49848"
FT                   /db_xref="InterPro:IPR018728"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSG6"
FT                   /protein_id="ACF49848.1"
FT                   /translation="MALLSASYAHHARCLMRALILIASPIALLQAQAAEHVGPAGHIVV
FT                   QTDDVTRFFKVLDANHGRPSANDLQHGYLDAGTDALRSFTDSRIGSMERLARAIQDKPA
FT                   LFAKARSCATALPSIRTRVAAAVDQLGALLPSARFPPVTVLVGRGNSGGVTTEAGVVIG
FT                   LEALCNADWMQADASDRFVHLIAHEYVHVQQPGARVDVEQPTLLYQTLLEGGAEYVAER
FT                   ISGQPANAHLQHWAQGRECALERAFLQDSMGTDLSRWLYNGPGDDTRRGDLGYWIGYRI
FT                   AHAYVARAPDMPNAIAELLAVQPGNAAALLEASGWQPACGAGESTQTHML"
     MALLSASYAH HARCLMRALI LIASPIALLQ AQAAEHVGPA GHIVVQTDDV TRFFKVLDAN        60
     HGRPSANDLQ HGYLDAGTDA LRSFTDSRIG SMERLARAIQ DKPALFAKAR SCATALPSIR       120
     TRVAAAVDQL GALLPSARFP PVTVLVGRGN SGGVTTEAGV VIGLEALCNA DWMQADASDR       180
     FVHLIAHEYV HVQQPGARVD VEQPTLLYQT LLEGGAEYVA ERISGQPANA HLQHWAQGRE       240
     CALERAFLQD SMGTDLSRWL YNGPGDDTRR GDLGYWIGYR IAHAYVARAP DMPNAIAELL       300
     AVQPGNAAAL LEASGWQPAC GAGESTQTHM L                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page