(data stored in ACNUC7421 zone)

EMBL: CP001111.PE146

CP001111.PE146       Location/Qualifiers
FT   CDS             183558..183926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0146"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: atc:AGR_C_2825 conserved
FT                   hypothetical protein VCA0415"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49851"
FT                   /db_xref="GOA:B4SSG9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSG9"
FT                   /protein_id="ACF49851.1"
FT                   /translation="MSHAAPPDAERRIDNIEFNVADIARSKRFYGEVFGWNFTDYGPAY
FT                   TEFDDGRLKGGLVSDTPVRAQGSPLVILYCADLADAQQRVIAAGGEVVQAVFAFPGGRR
FT                   FHFRDLDGYELAVWSDVD"
     MSHAAPPDAE RRIDNIEFNV ADIARSKRFY GEVFGWNFTD YGPAYTEFDD GRLKGGLVSD        60
     TPVRAQGSPL VILYCADLAD AQQRVIAAGG EVVQAVFAFP GGRRFHFRDL DGYELAVWSD       120
     VD                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page