(data stored in ACNUC7421 zone)

EMBL: CP001111.PE151

CP001111.PE151       Location/Qualifiers
FT   CDS             complement(188678..189802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0151"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   xac:XAC3528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49856"
FT                   /db_xref="GOA:B4SSH4"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSH4"
FT                   /protein_id="ACF49856.1"
FT                   /translation="MTSSSHRVQGLNNDEVAADWPPISAADLAWLRQRFPQLDADSHPH
FT                   WHSPRPLSAAAIVNGTRGPVFIKRHHHSVRSAACLEEEHHFIAHLAAAGVPVVQVLAAA
FT                   DGHTAVEHGEWTFELHAVGVGEDLYRDAASWSLLTDVAQAREAGRMLAELHRAAASYHA
FT                   PQRSTHLLVARDDLIRADDPIAAIKAGLHERSGLARYLARIPWEAQLQRDVLPWHAGLA
FT                   ERLRDEPRLWAHNDWHVSNLLWRDGQVSTVLDFGLASPTSALFDLATAIERNAVAWLEL
FT                   ERGMEAVRIDIALALIDGYRKVLPLSAARVQLLADLLPMVHFDFALSEVEYFEGITGST
FT                   ANADVAWQPFMLGHPAWFHSAPGQALLQALRAAA"
     MTSSSHRVQG LNNDEVAADW PPISAADLAW LRQRFPQLDA DSHPHWHSPR PLSAAAIVNG        60
     TRGPVFIKRH HHSVRSAACL EEEHHFIAHL AAAGVPVVQV LAAADGHTAV EHGEWTFELH       120
     AVGVGEDLYR DAASWSLLTD VAQAREAGRM LAELHRAAAS YHAPQRSTHL LVARDDLIRA       180
     DDPIAAIKAG LHERSGLARY LARIPWEAQL QRDVLPWHAG LAERLRDEPR LWAHNDWHVS       240
     NLLWRDGQVS TVLDFGLASP TSALFDLATA IERNAVAWLE LERGMEAVRI DIALALIDGY       300
     RKVLPLSAAR VQLLADLLPM VHFDFALSEV EYFEGITGST ANADVAWQPF MLGHPAWFHS       360
     APGQALLQAL RAAA                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page