(data stored in ACNUC7421 zone)

EMBL: CP001111.PE156

CP001111.PE156       Location/Qualifiers
FT   CDS             194560..198159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0156"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; Hpt domain protein; PAS fold-3 domain protein;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   pen:PSEEN3768 two-component sensor/response regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49861"
FT                   /db_xref="GOA:B4SSH9"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSH9"
FT                   /protein_id="ACF49861.1"
FT                   /translation="MRSWAVRGLVLLLAVLVLPAAPVQAVPGLLPLTPLQREYLAAHPS
FT                   IVVGQYDSGWPPFESLRDGQQVGLGPDYLSLLARQLGVKVEARRYPDWTSVLDAACRGE
FT                   IDVVMNVGLSADRTRCMVYTAAYGEAPLALVGRPDDLRASDIPDLDGLRVVIEQDFLTG
FT                   PQVRARFPRARQLVANSSLTALQMVRDDKADVYIGNAYVATELIASQRLQGVVLLRPSD
FT                   LPPEQLHFGIPNSKQPLAEALDLALAATSQAQCDALVQRWLPLPQWSASARLALSQAEK
FT                   RVLEQPLKIGFAPNAAPLSFADKEGKPSGLASEYLRRLLQAGANLQPENSHDWYEVREK
FT                   ARRGELQAVMGIPADSRYLGPDWVFSQPFISVPNVIVSRVDSPALLGLSDLQGKRVLLS
FT                   DPERIRGYVLQQAPSARIIAARSAEQALQRLAAGEADAYVGNLALVDHLLRSSFPGRLQ
FT                   VAAPAGFNDQLVLAVERRHAALATTFDRLLLQMTPRKREALRGDWLAVEYRNGIDWRHA
FT                   LRWGLPLLLVLLTALLVHGIGYWRLRREVAGRRHLEQRLAEVTDNLPAVVYQARRDADG
FT                   TLGFPFIAGDLQALFGITRQQAEQDAKLLLERIEEEDRERILQAVEQAARQFAPLILEF
FT                   RLRADAGGARWVRSQAHPYAAEAGAVTWSGYWVDVSEARAQAEALTAAKAEAEQAAEAK
FT                   SRFLATMSHEIRTPMSGVLGMLEVLAHSPLDAEQQRILGVIEDSAQMLRQILDDILDYS
FT                   RLEAGALRLEPVPQPLRPLLESVCRLLSAQASARGLALLVEIDPQLAPAHEVDGVRLRQ
FT                   IVFNLLSNAIKFTARGEVRLQLEVLGPTAEDGSQPLCLSVTDTGMGIAPEQLQHLFAPF
FT                   TQAGAYIQRDHGGTGLGLSISQRLVQMMDGELTLHSTLGEGTRAEVRLSLVEAGSGDVE
FT                   ALVAEQEQASLLPPALRQARVLVIEDHPTNQAMMAWRLQQLGVPHVMVGDGQQGLDRLL
FT                   SESFDLVITDCRMPVLDGFGFTRLLREREGRNGQPRLTVLALTASVLDDDARRCREAGM
FT                   DEVLAKPLSLATLRAALLRWLPQAQGQSFAEPVTEVVADDGMALPDLSTLQQRFGSRAV
FT                   AIQLRDSLLQASEGDLAAVQRALQAGDREAAALHLHRQAGGLGAIGATVLAGQANALVE
FT                   RLQDAAETDPAPVFASVAEFVARLQQQLQRLAH"
     MRSWAVRGLV LLLAVLVLPA APVQAVPGLL PLTPLQREYL AAHPSIVVGQ YDSGWPPFES        60
     LRDGQQVGLG PDYLSLLARQ LGVKVEARRY PDWTSVLDAA CRGEIDVVMN VGLSADRTRC       120
     MVYTAAYGEA PLALVGRPDD LRASDIPDLD GLRVVIEQDF LTGPQVRARF PRARQLVANS       180
     SLTALQMVRD DKADVYIGNA YVATELIASQ RLQGVVLLRP SDLPPEQLHF GIPNSKQPLA       240
     EALDLALAAT SQAQCDALVQ RWLPLPQWSA SARLALSQAE KRVLEQPLKI GFAPNAAPLS       300
     FADKEGKPSG LASEYLRRLL QAGANLQPEN SHDWYEVREK ARRGELQAVM GIPADSRYLG       360
     PDWVFSQPFI SVPNVIVSRV DSPALLGLSD LQGKRVLLSD PERIRGYVLQ QAPSARIIAA       420
     RSAEQALQRL AAGEADAYVG NLALVDHLLR SSFPGRLQVA APAGFNDQLV LAVERRHAAL       480
     ATTFDRLLLQ MTPRKREALR GDWLAVEYRN GIDWRHALRW GLPLLLVLLT ALLVHGIGYW       540
     RLRREVAGRR HLEQRLAEVT DNLPAVVYQA RRDADGTLGF PFIAGDLQAL FGITRQQAEQ       600
     DAKLLLERIE EEDRERILQA VEQAARQFAP LILEFRLRAD AGGARWVRSQ AHPYAAEAGA       660
     VTWSGYWVDV SEARAQAEAL TAAKAEAEQA AEAKSRFLAT MSHEIRTPMS GVLGMLEVLA       720
     HSPLDAEQQR ILGVIEDSAQ MLRQILDDIL DYSRLEAGAL RLEPVPQPLR PLLESVCRLL       780
     SAQASARGLA LLVEIDPQLA PAHEVDGVRL RQIVFNLLSN AIKFTARGEV RLQLEVLGPT       840
     AEDGSQPLCL SVTDTGMGIA PEQLQHLFAP FTQAGAYIQR DHGGTGLGLS ISQRLVQMMD       900
     GELTLHSTLG EGTRAEVRLS LVEAGSGDVE ALVAEQEQAS LLPPALRQAR VLVIEDHPTN       960
     QAMMAWRLQQ LGVPHVMVGD GQQGLDRLLS ESFDLVITDC RMPVLDGFGF TRLLREREGR      1020
     NGQPRLTVLA LTASVLDDDA RRCREAGMDE VLAKPLSLAT LRAALLRWLP QAQGQSFAEP      1080
     VTEVVADDGM ALPDLSTLQQ RFGSRAVAIQ LRDSLLQASE GDLAAVQRAL QAGDREAAAL      1140
     HLHRQAGGLG AIGATVLAGQ ANALVERLQD AAETDPAPVF ASVAEFVARL QQQLQRLAH       1199
//

If you have problems or comments...

PBIL Back to PBIL home page