(data stored in ACNUC7421 zone)

EMBL: CP001111.PE165

CP001111.PE165       Location/Qualifiers
FT   CDS             205097..207946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0165"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   xcv:XCV0666 putative zinc metalloprotease precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49870"
FT                   /db_xref="GOA:B4SSI8"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSI8"
FT                   /protein_id="ACF49870.1"
FT                   /translation="MSLALRPRAALLAVALSTALGTLAPTSALAAKPAAPAKVDIPFEQ
FT                   FTLPNGLRVIVHTDRKAPIVAVNVWYHVGSKDEPAGRTGFAHLFEHLMFQSSENHDGEY
FT                   FEPFKQVGATGQNGTTNTDRTNYFENVPTTALDMALWMESDRMGHLVGAIDQAALDEQR
FT                   GVVQNEKRQGENQPYGQAWDQLNKALYPVGHPYHHGVIGSMNDLNAASLDDVKTWFRTW
FT                   YGPNNAVLVLAGDIDLATAKEKAARYFGSIPAGPSMAQPAVNVAKRSADTRETMTDKVP
FT                   QARIYRAWNVPQVGTTDIDQLQLFAEVLGGAKSSRLSQRLQHQDKLVDSIGSGLSASQL
FT                   GSNFVIVATVKQGQDPAKVEKIIDEELDRLIKQGPTAAELERAKTGARAGFIRGIERIG
FT                   GFGGKADALAECAVFTGDPGCFRTSLANIDKASAADLSRLGAQWLDKGSHTLVIAPGER
FT                   VALKEDPSQAPKPFNVPAVDPKYSTLPEQVDRKAGVPQTREFPQLKFPALQRATLKNGT
FT                   QVILAERHEIPVVQFSYQFPGGFSADQGRKPGTANFTMSLMTEGAGRLGSLAFADAADA
FT                   LGASLDASAGLDSMSVDLSALKENLAPSLALYRDLLREPRFEQGEIDRVKATWIAGIQQ
FT                   EKVNPGAVAMRVLPPLLYGKGHPYAIPFTGSGDEAAINGLTREDLVDFHQDWLRPQNGT
FT                   LIVVGDTTLAEIVPLLDKQLADWKATGEAPQVKAATDVALPKGPRVFLIDQPGAVQANL
FT                   FAGQVVPPSSAASSTRFDIANGVIGGDFTSRLNMNLREDKHWSYGARSSASNSVGQRPW
FT                   MASAPVQIDKTGPALAEMRKEIAAFADGSKPATAGEVNRIRNIQTLSLPGAYETASAVA
FT                   ASIGSIVQFKRPDDYVLRRKAEIEAMTPAQVQQAAAEIKPQALTWVVVGDLKQTEAAVR
FT                   ALNLGEVTVIDAEGNPVKK"
     MSLALRPRAA LLAVALSTAL GTLAPTSALA AKPAAPAKVD IPFEQFTLPN GLRVIVHTDR        60
     KAPIVAVNVW YHVGSKDEPA GRTGFAHLFE HLMFQSSENH DGEYFEPFKQ VGATGQNGTT       120
     NTDRTNYFEN VPTTALDMAL WMESDRMGHL VGAIDQAALD EQRGVVQNEK RQGENQPYGQ       180
     AWDQLNKALY PVGHPYHHGV IGSMNDLNAA SLDDVKTWFR TWYGPNNAVL VLAGDIDLAT       240
     AKEKAARYFG SIPAGPSMAQ PAVNVAKRSA DTRETMTDKV PQARIYRAWN VPQVGTTDID       300
     QLQLFAEVLG GAKSSRLSQR LQHQDKLVDS IGSGLSASQL GSNFVIVATV KQGQDPAKVE       360
     KIIDEELDRL IKQGPTAAEL ERAKTGARAG FIRGIERIGG FGGKADALAE CAVFTGDPGC       420
     FRTSLANIDK ASAADLSRLG AQWLDKGSHT LVIAPGERVA LKEDPSQAPK PFNVPAVDPK       480
     YSTLPEQVDR KAGVPQTREF PQLKFPALQR ATLKNGTQVI LAERHEIPVV QFSYQFPGGF       540
     SADQGRKPGT ANFTMSLMTE GAGRLGSLAF ADAADALGAS LDASAGLDSM SVDLSALKEN       600
     LAPSLALYRD LLREPRFEQG EIDRVKATWI AGIQQEKVNP GAVAMRVLPP LLYGKGHPYA       660
     IPFTGSGDEA AINGLTREDL VDFHQDWLRP QNGTLIVVGD TTLAEIVPLL DKQLADWKAT       720
     GEAPQVKAAT DVALPKGPRV FLIDQPGAVQ ANLFAGQVVP PSSAASSTRF DIANGVIGGD       780
     FTSRLNMNLR EDKHWSYGAR SSASNSVGQR PWMASAPVQI DKTGPALAEM RKEIAAFADG       840
     SKPATAGEVN RIRNIQTLSL PGAYETASAV AASIGSIVQF KRPDDYVLRR KAEIEAMTPA       900
     QVQQAAAEIK PQALTWVVVG DLKQTEAAVR ALNLGEVTVI DAEGNPVKK                   949
//

If you have problems or comments...

PBIL Back to PBIL home page