(data stored in ACNUC7421 zone)

EMBL: CP001111.PE166

CP001111.PE166       Location/Qualifiers
FT   CDS             208151..208468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0166"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: xcv:XCV0238 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49871"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSI9"
FT                   /protein_id="ACF49871.1"
FT                   /translation="MRVLLLSSLLLTVTACTWVPIEPAGKTTRVLPAGPVPAGCIAKGE
FT                   VVVTVKSKVGFYNRNPLRVQEELETLARNEAPSAGANAVQAAAAPADGSQRFAAFQCPP
FT                   R"
     MRVLLLSSLL LTVTACTWVP IEPAGKTTRV LPAGPVPAGC IAKGEVVVTV KSKVGFYNRN        60
     PLRVQEELET LARNEAPSAG ANAVQAAAAP ADGSQRFAAF QCPPR                       105
//

If you have problems or comments...

PBIL Back to PBIL home page