(data stored in ACNUC7421 zone)

EMBL: CP001111.PE167

CP001111.PE167       Location/Qualifiers
FT   CDS             208572..209588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0167"
FT                   /product="3-Oxoacyl-(acyl-carrier-protein (ACP)) synthase
FT                   III domain protein"
FT                   /note="PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein; KEGG: xcb:XC_0222
FT                   3-oxoacyl-(acyl carrier protein) synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49872"
FT                   /db_xref="GOA:B4SSJ0"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSJ0"
FT                   /protein_id="ACF49872.1"
FT                   /translation="MLFKNVSIAGLAHVDAPHTLTTKEINERLQPTLDRLGIRTDVLGD
FT                   IAGIHARRLWDNGVLASDAATMAGRKALEDAGINATQVGLLVNTSVSRDYLEPSTASIV
FT                   SGNLGVSDECMTFDVANACLAFINGMDIAARMIERGDIDYALVVDGETANLVYEKTLER
FT                   MTAPDVTADDFRNELAALTTGSGAAAMVMARSELVPDAPRYKGGVTRSATEWNQLCLGN
FT                   LDRMVTDTRLLLIEGIKLAQKTFTAAKIALGWAVEELDQFVIHQVSQPHTAAFIKNFGI
FT                   DPKKVMTIFGEHGNIGPASVPIVLSKLKQLGKLKKGDRIALLGIGSGLNCSMAEVVW"
     MLFKNVSIAG LAHVDAPHTL TTKEINERLQ PTLDRLGIRT DVLGDIAGIH ARRLWDNGVL        60
     ASDAATMAGR KALEDAGINA TQVGLLVNTS VSRDYLEPST ASIVSGNLGV SDECMTFDVA       120
     NACLAFINGM DIAARMIERG DIDYALVVDG ETANLVYEKT LERMTAPDVT ADDFRNELAA       180
     LTTGSGAAAM VMARSELVPD APRYKGGVTR SATEWNQLCL GNLDRMVTDT RLLLIEGIKL       240
     AQKTFTAAKI ALGWAVEELD QFVIHQVSQP HTAAFIKNFG IDPKKVMTIF GEHGNIGPAS       300
     VPIVLSKLKQ LGKLKKGDRI ALLGIGSGLN CSMAEVVW                               338
//

If you have problems or comments...

PBIL Back to PBIL home page