(data stored in ACNUC7421 zone)

EMBL: CP001111.PE17

CP001111.PE17        Location/Qualifiers
FT   CDS             20769..22985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0017"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: YD
FT                   repeat-containing protein; KEGG: sdn:Sden_2443 YD repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49722"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR21"
FT                   /protein_id="ACF49722.1"
FT                   /translation="MPALTLALIGLNAVVSVNTYEYDELGRVIVERGNGVQNVRYAYDA
FT                   EGRVTQVTDSQNRVTRMSYDPRGRLIKSIDAVGGTTQIAYDLADRPVRVSDPRNLVTTY
FT                   EFDGFGQMWKQVSPDTGTTQHQYDAAGLRTSTTRADGSVVSFGYDGLGRMTSASAEGRT
FT                   MGYSYDWCGNGKGQMCGTSGPGTATHFAYTPNGQLQIRRDFTDLSGQKTDYSTTYGYDG
FT                   INRLSQIIYPNGDKATYTYGSQGKPSALTATVDGTQRSIISQANWKVTGAHEWLAYGNG
FT                   LARGYNHDQEGRLTAMSVWGPNGSKVSYWDYQYSADGEITAIVDAVDPNMTQLIGYDAL
FT                   SRMTKLTRFGVINNLSYDAGGNHDRYQAGNQLTQYSIDPGSNRVLNYTNQDGSRQYQYD
FT                   ALGNRISETAGSRISTYEYDAFNRMSRSNIGGTATDYVLNAQGQRVAKVNKNINSRYFY
FT                   AGQNQLMTELNNGVWTNYFWFEGELVGLARSGQHNYVHTDHLGRPEFVTSPSQQTVWKA
FT                   YNYAYGRSVQKDEIGGLNIGFPGQYYDVESGLWYNGFRDYDASIGRYVQSDPIGLAGGL
FT                   NTYAYAEGNPVTGFDPLGLCKTDYVGAILGAADMAAGVGAITAGSADSIIAAVAGSEDG
FT                   GLVGLTVAAMGLATFHDGANNLATAFDGKERTPALEKVGGSLLGWQGAQIGRYVSNFNT
FT                   ITSLSKGIRSVLKGTAKLSDAHEIAKGIKENGGGPASPCDCGGK"
     MPALTLALIG LNAVVSVNTY EYDELGRVIV ERGNGVQNVR YAYDAEGRVT QVTDSQNRVT        60
     RMSYDPRGRL IKSIDAVGGT TQIAYDLADR PVRVSDPRNL VTTYEFDGFG QMWKQVSPDT       120
     GTTQHQYDAA GLRTSTTRAD GSVVSFGYDG LGRMTSASAE GRTMGYSYDW CGNGKGQMCG       180
     TSGPGTATHF AYTPNGQLQI RRDFTDLSGQ KTDYSTTYGY DGINRLSQII YPNGDKATYT       240
     YGSQGKPSAL TATVDGTQRS IISQANWKVT GAHEWLAYGN GLARGYNHDQ EGRLTAMSVW       300
     GPNGSKVSYW DYQYSADGEI TAIVDAVDPN MTQLIGYDAL SRMTKLTRFG VINNLSYDAG       360
     GNHDRYQAGN QLTQYSIDPG SNRVLNYTNQ DGSRQYQYDA LGNRISETAG SRISTYEYDA       420
     FNRMSRSNIG GTATDYVLNA QGQRVAKVNK NINSRYFYAG QNQLMTELNN GVWTNYFWFE       480
     GELVGLARSG QHNYVHTDHL GRPEFVTSPS QQTVWKAYNY AYGRSVQKDE IGGLNIGFPG       540
     QYYDVESGLW YNGFRDYDAS IGRYVQSDPI GLAGGLNTYA YAEGNPVTGF DPLGLCKTDY       600
     VGAILGAADM AAGVGAITAG SADSIIAAVA GSEDGGLVGL TVAAMGLATF HDGANNLATA       660
     FDGKERTPAL EKVGGSLLGW QGAQIGRYVS NFNTITSLSK GIRSVLKGTA KLSDAHEIAK       720
     GIKENGGGPA SPCDCGGK                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page