(data stored in ACNUC7421 zone)

EMBL: CP001111.PE172

CP001111.PE172       Location/Qualifiers
FT   CDS             213971..214126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0172"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   xac:XAC0239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49877"
FT                   /db_xref="GOA:B4SSJ5"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSJ5"
FT                   /protein_id="ACF49877.1"
FT                   /translation="MLHYAVIFFVIAIIAAVLGFSGIAGAASNIAWILFVVFLVLAVIS
FT                   MFRKRG"
     MLHYAVIFFV IAIIAAVLGF SGIAGAASNI AWILFVVFLV LAVISMFRKR G                 51
//

If you have problems or comments...

PBIL Back to PBIL home page