(data stored in ACNUC7421 zone)

EMBL: CP001111.PE179

CP001111.PE179       Location/Qualifiers
FT   CDS             220445..220876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0179"
FT                   /product="Class I peptide chain release factor"
FT                   /note="PFAM: Class I peptide chain release factor; KEGG:
FT                   xcb:XC_0237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49884"
FT                   /db_xref="GOA:B4SSK2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSK2"
FT                   /protein_id="ACF49884.1"
FT                   /translation="MGSGPVTISAQLEIPDGEIVERFVRASGAGGQNVNKVSTAVELRF
FT                   DVAGSPSLPEPLRERLLARRDRRMTGEGVLVIDAQRFRTQDRNREDARDRLAAFIQAGL
FT                   HVPKPRKATKPTLGSKLRRLDAKRGRAQVKRGRSSRDWE"
     MGSGPVTISA QLEIPDGEIV ERFVRASGAG GQNVNKVSTA VELRFDVAGS PSLPEPLRER        60
     LLARRDRRMT GEGVLVIDAQ RFRTQDRNRE DARDRLAAFI QAGLHVPKPR KATKPTLGSK       120
     LRRLDAKRGR AQVKRGRSSR DWE                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page