(data stored in ACNUC7421 zone)

EMBL: CP001111.PE184

CP001111.PE184       Location/Qualifiers
FT   CDS             225002..225628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0184"
FT                   /product="signal peptidase I"
FT                   /note="TIGRFAM: signal peptidase I; PFAM: peptidase S24 and
FT                   S26 domain protein; KEGG: swd:Swoo_0360 signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49889"
FT                   /db_xref="GOA:B4SSK7"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSK7"
FT                   /protein_id="ACF49889.1"
FT                   /translation="MDAVARPPFSERALVWLKKEALPLLVMLGLLAAARDTLANHYVVP
FT                   SGSMQPTLQPGDRVVVDMRAYGLRLPFTGKELMATGTPQRGEVAVFDSPADGTRLIKRV
FT                   AAVAGDHVQLREGHLSINGQPLQIADLQDVEAFGDRHASLDLDMGGGPDIADLVVPDGK
FT                   VLVLGDHRGNSFDGRFFGFVDADKVYGRAVAVYYRRGAGFEWQRL"
     MDAVARPPFS ERALVWLKKE ALPLLVMLGL LAAARDTLAN HYVVPSGSMQ PTLQPGDRVV        60
     VDMRAYGLRL PFTGKELMAT GTPQRGEVAV FDSPADGTRL IKRVAAVAGD HVQLREGHLS       120
     INGQPLQIAD LQDVEAFGDR HASLDLDMGG GPDIADLVVP DGKVLVLGDH RGNSFDGRFF       180
     GFVDADKVYG RAVAVYYRRG AGFEWQRL                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page