(data stored in ACNUC7421 zone)

EMBL: CP001111.PE186

CP001111.PE186       Location/Qualifiers
FT   CDS             complement(227092..228000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0186"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: psa:PST_0564 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49891"
FT                   /db_xref="GOA:B4SSK9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSK9"
FT                   /protein_id="ACF49891.1"
FT                   /translation="MSIELRHLRYFLAVADTLHFGQAAERLGMSQPPLSQQIRQLEDLI
FT                   GARLFVRSHRRVQLTAAGELLQERARAIVLQVESAVDEVQRAQRGEQGELRIGLTRATP
FT                   LSPQIPRSILQYRQRYPQVRLQLSEMNTLQQIDALLDGSLDVGIIRKRALPPELVAHSL
FT                   FVDPLALIVHADHPALRRLSKQGTLSLRDFAQEPFVAFRRSAGAGIHDHMIALCAAAGF
FT                   TPRIVQEAGEASTLISLAAAGLGAAILPSSCDHIRVEGARFVALADAGAHSEVQLAWHR
FT                   EGVTPLIRNFAGLLREAFAEG"
     MSIELRHLRY FLAVADTLHF GQAAERLGMS QPPLSQQIRQ LEDLIGARLF VRSHRRVQLT        60
     AAGELLQERA RAIVLQVESA VDEVQRAQRG EQGELRIGLT RATPLSPQIP RSILQYRQRY       120
     PQVRLQLSEM NTLQQIDALL DGSLDVGIIR KRALPPELVA HSLFVDPLAL IVHADHPALR       180
     RLSKQGTLSL RDFAQEPFVA FRRSAGAGIH DHMIALCAAA GFTPRIVQEA GEASTLISLA       240
     AAGLGAAILP SSCDHIRVEG ARFVALADAG AHSEVQLAWH REGVTPLIRN FAGLLREAFA       300
     EG                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page