(data stored in ACNUC7421 zone)

EMBL: CP001111.PE187

CP001111.PE187       Location/Qualifiers
FT   CDS             complement(228277..229245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0187"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: xac:XAC0255 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49892"
FT                   /db_xref="GOA:B4SSL0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSL0"
FT                   /protein_id="ACF49892.1"
FT                   /translation="MTTRPPPSPRFSYKSDRLKPLRAFCQTVRLGSVSRAAEALFVSQP
FT                   AISLQLQALERELGVPLFERSGRRLVPSREGQLLYEMAQPLVENLDGLEARFRDKVRGL
FT                   DAGELNIAANSSTILYLLPKIVERFRLHHPDVRLTLHNAISADGTDLLREDAADLAIGS
FT                   MTDVPADLSYAPAYRFEQVLIAPHDHPLASGGELELADIARYPLVLPPKRQITYRLVDQ
FT                   VFQRHRIAYTVALEVGGWEVIKQYVAMGMGISIVPALCLNEADRERLAARSMKRWFPER
FT                   SYGVIVRRGKALSAQARAFIELIQPELFSPRDYDQSGHSER"
     MTTRPPPSPR FSYKSDRLKP LRAFCQTVRL GSVSRAAEAL FVSQPAISLQ LQALERELGV        60
     PLFERSGRRL VPSREGQLLY EMAQPLVENL DGLEARFRDK VRGLDAGELN IAANSSTILY       120
     LLPKIVERFR LHHPDVRLTL HNAISADGTD LLREDAADLA IGSMTDVPAD LSYAPAYRFE       180
     QVLIAPHDHP LASGGELELA DIARYPLVLP PKRQITYRLV DQVFQRHRIA YTVALEVGGW       240
     EVIKQYVAMG MGISIVPALC LNEADRERLA ARSMKRWFPE RSYGVIVRRG KALSAQARAF       300
     IELIQPELFS PRDYDQSGHS ER                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page