(data stored in ACNUC7421 zone)

EMBL: CP001111.PE191

CP001111.PE191       Location/Qualifiers
FT   CDS             233836..236340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0191"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /note="PFAM: Tetratricopeptide TPR_4; SMART:
FT                   Tetratricopeptide domain protein; KEGG: xcb:XC_0250
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49896"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR030966"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSL4"
FT                   /protein_id="ACF49896.1"
FT                   /translation="MNGDNGTSTPHNQQLRALLFTDLCDSLLLVERIGDVAAAELFQEH
FT                   DRLVLALQQRWHGQLIDRSDGLFMLFERPIDALGFALDYQRGLQPLGQARDLRLQARAG
FT                   LHVGEVILWNNSSESIALGAKAVEVEGLAKPMAARLMQLAPPGQLLMSAAAESVVRRAA
FT                   TELGELGGRLQWRSFGRWRFRGVAQPMEVLGVAVAGKGMLSRPRASDKARPDVPVWRRP
FT                   LAMAAQAALIVSVGLGLWLLARPQPAIAFAERDWVVMADARNLTDNPVLDDALNQALRI
FT                   GLEQSRYVNVISDVKARDTMARMLMPENTEIDRTAAVQIAMRDGARAVLDPSIREVHGQ
FT                   LRVAVDVVNPATGETVYSVYSDGKGLPSALTSSDQVVVQLRSRLGEAMAQIGKTSAPLP
FT                   QVATANLDALHAYARGQLAYGRGQTESSLKFFQIATRIDPDFAMAYVGQMRSMFSQGQL
FT                   EDARGLLTKVRTLRHRLSTREGLYLDAWQVELESGSESAAGEAWKVLADLYPDHHGASV
FT                   NHGLAEFVLGHYEKAEQAVAHANVEQNPLRSVTLELLGRIQLARGKVDEAVATLHRAMQ
FT                   LAEGRPNRQLVAALAVSGRNAEASAVLARLPENGPGRWLEGTSLAIDEGRFEEALAASV
FT                   ASAGRCNGGPFACDLLGTVNLAVHAAAARCVAPRDFATQASALLRNAARPDNGERGQYL
FT                   YFAAASLYAAQRLGLQSSIGRQVAELDVLAADAVDPRARQLAAVVKANALHLSGDSAQA
FT                   IKMLQAMVDGSELFQVHSVLAAAYAAQGAIQEQQSQLDWMRRHRGRAYTEFAGSSVLQA
FT                   LNVGDSQRGPSRPGCALSPDAS"
     MNGDNGTSTP HNQQLRALLF TDLCDSLLLV ERIGDVAAAE LFQEHDRLVL ALQQRWHGQL        60
     IDRSDGLFML FERPIDALGF ALDYQRGLQP LGQARDLRLQ ARAGLHVGEV ILWNNSSESI       120
     ALGAKAVEVE GLAKPMAARL MQLAPPGQLL MSAAAESVVR RAATELGELG GRLQWRSFGR       180
     WRFRGVAQPM EVLGVAVAGK GMLSRPRASD KARPDVPVWR RPLAMAAQAA LIVSVGLGLW       240
     LLARPQPAIA FAERDWVVMA DARNLTDNPV LDDALNQALR IGLEQSRYVN VISDVKARDT       300
     MARMLMPENT EIDRTAAVQI AMRDGARAVL DPSIREVHGQ LRVAVDVVNP ATGETVYSVY       360
     SDGKGLPSAL TSSDQVVVQL RSRLGEAMAQ IGKTSAPLPQ VATANLDALH AYARGQLAYG       420
     RGQTESSLKF FQIATRIDPD FAMAYVGQMR SMFSQGQLED ARGLLTKVRT LRHRLSTREG       480
     LYLDAWQVEL ESGSESAAGE AWKVLADLYP DHHGASVNHG LAEFVLGHYE KAEQAVAHAN       540
     VEQNPLRSVT LELLGRIQLA RGKVDEAVAT LHRAMQLAEG RPNRQLVAAL AVSGRNAEAS       600
     AVLARLPENG PGRWLEGTSL AIDEGRFEEA LAASVASAGR CNGGPFACDL LGTVNLAVHA       660
     AAARCVAPRD FATQASALLR NAARPDNGER GQYLYFAAAS LYAAQRLGLQ SSIGRQVAEL       720
     DVLAADAVDP RARQLAAVVK ANALHLSGDS AQAIKMLQAM VDGSELFQVH SVLAAAYAAQ       780
     GAIQEQQSQL DWMRRHRGRA YTEFAGSSVL QALNVGDSQR GPSRPGCALS PDAS             834
//

If you have problems or comments...

PBIL Back to PBIL home page