(data stored in ACNUC7421 zone)

EMBL: CP001111.PE196

CP001111.PE196       Location/Qualifiers
FT   CDS             complement(239128..241110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0196"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; phosphoribosylglycinamide synthetase;
FT                   ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp; Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; KEGG:
FT                   xcv:XCV0271 biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49901"
FT                   /db_xref="GOA:B4SSL9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSL9"
FT                   /protein_id="ACF49901.1"
FT                   /translation="MFTKVLIANRGEIACRVIATCRRLGIATVAVYSDADRNARHVRLA
FT                   DEAIHIGPAAARESYLRGDVLLDAARRSGAQAIHPGYGFLSENADFADACAAAGITFIG
FT                   PPASAIRAMGDKSAAKALMAKAGVPLTPGYHGDQQAPDFLRAQADGIGYPVLIKASAGG
FT                   GGKGMRKVERSEDFVDALASCQREAASAFGNDHVLVEKYVERPRHIEIQVFGDSHGEAV
FT                   YLFERDCSVQRRHQKVLEEAPAPGMSAERRAAMGKAAVDAARAVGYVGAGTVEFIAGPD
FT                   GDFYFMEMNTRLQVEHPVTEYITGTDLVEWQLRVASGQPLPLRQEQLAIHGHAIEARLY
FT                   AEDADRGFLPSTGTLRRLRLPMPSANVRVDTGVEEGDSISPYYDPMIAKLIVWDVDRDA
FT                   ALRRMSQALADCQVVGVTTNAGFLRRLVNTDSFAHAKLDTALIEREQAALSAAGDSDDA
FT                   LWQLAAVAAVASTADAGIDARDPHSPWQAQDGWRLGASTPRALPLQQGERTHTLKVWVQ
FT                   ADGWRVQSDDAAPVQVIGTANAQGLTVQLGERRWSLQLLREGDQLYLFGADGQHRFTLH
FT                   DPVGESDTAVADAGSLLAPMPGKIVATLVAAGTEVKRGTPLVVLEAMKMEHTLQAPADG
FT                   TVKGYRAKAGDQVGDGAVLVDFEAA"
     MFTKVLIANR GEIACRVIAT CRRLGIATVA VYSDADRNAR HVRLADEAIH IGPAAARESY        60
     LRGDVLLDAA RRSGAQAIHP GYGFLSENAD FADACAAAGI TFIGPPASAI RAMGDKSAAK       120
     ALMAKAGVPL TPGYHGDQQA PDFLRAQADG IGYPVLIKAS AGGGGKGMRK VERSEDFVDA       180
     LASCQREAAS AFGNDHVLVE KYVERPRHIE IQVFGDSHGE AVYLFERDCS VQRRHQKVLE       240
     EAPAPGMSAE RRAAMGKAAV DAARAVGYVG AGTVEFIAGP DGDFYFMEMN TRLQVEHPVT       300
     EYITGTDLVE WQLRVASGQP LPLRQEQLAI HGHAIEARLY AEDADRGFLP STGTLRRLRL       360
     PMPSANVRVD TGVEEGDSIS PYYDPMIAKL IVWDVDRDAA LRRMSQALAD CQVVGVTTNA       420
     GFLRRLVNTD SFAHAKLDTA LIEREQAALS AAGDSDDALW QLAAVAAVAS TADAGIDARD       480
     PHSPWQAQDG WRLGASTPRA LPLQQGERTH TLKVWVQADG WRVQSDDAAP VQVIGTANAQ       540
     GLTVQLGERR WSLQLLREGD QLYLFGADGQ HRFTLHDPVG ESDTAVADAG SLLAPMPGKI       600
     VATLVAAGTE VKRGTPLVVL EAMKMEHTLQ APADGTVKGY RAKAGDQVGD GAVLVDFEAA       660
//

If you have problems or comments...

PBIL Back to PBIL home page