(data stored in ACNUC7421 zone)

EMBL: CP001111.PE198

CP001111.PE198       Location/Qualifiers
FT   CDS             complement(242758..243921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0198"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: xcv:XCV0273
FT                   acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49903"
FT                   /db_xref="GOA:B4SSM1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSM1"
FT                   /protein_id="ACF49903.1"
FT                   /translation="MHVPSLNFDLGEDIDLLRQSVAHFAAAEVAPLAAEADATNQFPLA
FT                   LWPKLGEQGLLGLTVEEEYGGTGMGYLAHVVAMEEISRASGGIGLSYGAHSNLCVNQLR
FT                   KNGNEEQKQRFLPGLCSGALVGALAMSEPGAGSDVVSMKLRADKRGDRYVLNGNKMWIT
FT                   NGPDADVLVVYAKTDMAAGAKGITAFLVEKGMKGFSTAQKLDKLGMRSSPTCELVFQDC
FT                   EVPEENVLGQVGGGVRVLMSGLDYERVVLSGGPLGLMAAAMDVVMPYVHERHQFGEAIG
FT                   SFQLIQAKIADMYVGLGACRAYVYAVARACDQGRTTRQDAAGAILYAAEKATWLTGQAI
FT                   QILGGNGYINEYPTGRLWRDAKLYEIGAGTSEIRRMLIGRELFQRTL"
     MHVPSLNFDL GEDIDLLRQS VAHFAAAEVA PLAAEADATN QFPLALWPKL GEQGLLGLTV        60
     EEEYGGTGMG YLAHVVAMEE ISRASGGIGL SYGAHSNLCV NQLRKNGNEE QKQRFLPGLC       120
     SGALVGALAM SEPGAGSDVV SMKLRADKRG DRYVLNGNKM WITNGPDADV LVVYAKTDMA       180
     AGAKGITAFL VEKGMKGFST AQKLDKLGMR SSPTCELVFQ DCEVPEENVL GQVGGGVRVL       240
     MSGLDYERVV LSGGPLGLMA AAMDVVMPYV HERHQFGEAI GSFQLIQAKI ADMYVGLGAC       300
     RAYVYAVARA CDQGRTTRQD AAGAILYAAE KATWLTGQAI QILGGNGYIN EYPTGRLWRD       360
     AKLYEIGAGT SEIRRMLIGR ELFQRTL                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page