(data stored in ACNUC7421 zone)

EMBL: CP001111.PE2

CP001111.PE2         Location/Qualifiers
FT   CDS             1823..2923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: xac:XAC0002 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49707"
FT                   /db_xref="GOA:B4SU12"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B4SU12"
FT                   /protein_id="ACF49707.1"
FT                   /translation="MRFTLQREAFLKPLAQVVNVVERRQTLPVLANFLVQVQNGQLSLT
FT                   GTDLEVEMVSRIAVEDAQDGETTIPARKLFEIIRALPDGSRITVSQTGDKITVQAGRSR
FT                   FTLATLPSNDFPSVDEVEATERVAIGEATLKELIERTAFAMAQQDVRYYLNGLLFDLRG
FT                   DALRTVATDGHRLALCETDLAKPSGSKRQIIVPRKGVTELQRLLESGDREIELEVGRSH
FT                   VRVKRDDVTFTSKLIDGRFPDYEAVIPIGADREVKVNRESLRASLQRAAILSNEKYRGI
FT                   RVEVSPGNLKISAHNPEQEEAQEEIEADTTVSDLAIGFNVNYLLDALSALRDEEVIIQL
FT                   RDSNSSALVRESSSEKSRHVVMPLRL"
     MRFTLQREAF LKPLAQVVNV VERRQTLPVL ANFLVQVQNG QLSLTGTDLE VEMVSRIAVE        60
     DAQDGETTIP ARKLFEIIRA LPDGSRITVS QTGDKITVQA GRSRFTLATL PSNDFPSVDE       120
     VEATERVAIG EATLKELIER TAFAMAQQDV RYYLNGLLFD LRGDALRTVA TDGHRLALCE       180
     TDLAKPSGSK RQIIVPRKGV TELQRLLESG DREIELEVGR SHVRVKRDDV TFTSKLIDGR       240
     FPDYEAVIPI GADREVKVNR ESLRASLQRA AILSNEKYRG IRVEVSPGNL KISAHNPEQE       300
     EAQEEIEADT TVSDLAIGFN VNYLLDALSA LRDEEVIIQL RDSNSSALVR ESSSEKSRHV       360
     VMPLRL                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page