(data stored in ACNUC7421 zone)

EMBL: CP001111.PE202

CP001111.PE202       Location/Qualifiers
FT   CDS             complement(247101..247958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0202"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: xcb:XC_0269 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49907"
FT                   /db_xref="GOA:B4SSM5"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSM5"
FT                   /protein_id="ACF49907.1"
FT                   /translation="MLYLSLAVICSVLVSVLLKLASRRQLDVSQMVTWNYLVAATLTAV
FT                   VLQPPLDALRAPHAPWLSLLALAVVLPSIFLVLGRAVAVAGIVRSDVAQRLSLLLSLAA
FT                   AFLFFGQTATPWKLAGLALGLLAMVAISLRPRGPAVASSPGGWGWLLGVWAGFAVVDVL
FT                   LKQVALSGTPSMAAVLASFSVAFVLMLALQLWRHASGRSRLAWRNLGAGALLGLLNGGN
FT                   ILFYVHAHQSMPDSPATVFAGMNIGVVVLGALVGVFAFGEATTKWNRAGLALAVLAIGL
FT                   IAWG"
     MLYLSLAVIC SVLVSVLLKL ASRRQLDVSQ MVTWNYLVAA TLTAVVLQPP LDALRAPHAP        60
     WLSLLALAVV LPSIFLVLGR AVAVAGIVRS DVAQRLSLLL SLAAAFLFFG QTATPWKLAG       120
     LALGLLAMVA ISLRPRGPAV ASSPGGWGWL LGVWAGFAVV DVLLKQVALS GTPSMAAVLA       180
     SFSVAFVLML ALQLWRHASG RSRLAWRNLG AGALLGLLNG GNILFYVHAH QSMPDSPATV       240
     FAGMNIGVVV LGALVGVFAF GEATTKWNRA GLALAVLAIG LIAWG                       285
//

If you have problems or comments...

PBIL Back to PBIL home page