(data stored in ACNUC7421 zone)

EMBL: CP001111.PE203

CP001111.PE203       Location/Qualifiers
FT   CDS             248002..248673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49908"
FT                   /db_xref="GOA:B4SSM6"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSM6"
FT                   /protein_id="ACF49908.1"
FT                   /translation="MHKPSFPVAAGETACLVLDGPVGPLEVVVDLPKADVPAQPIVAII
FT                   CHPLSTEGGTLHNKVVTMTATTLREQGIATVRFNFRSVGGSAGEFDHGVGEQDDLKAVA
FT                   AWVRSQRPDDRLWLAGFSFGSFVSLKAAAELQPEALISIAPPAGRWDFDGIAPPARWLV
FT                   IQGEQDEIVDPQAVYQWLDTLDFPHELVRMPETSHFFHRKLIDLRGALTHGVKHWLGAA
FT                   A"
     MHKPSFPVAA GETACLVLDG PVGPLEVVVD LPKADVPAQP IVAIICHPLS TEGGTLHNKV        60
     VTMTATTLRE QGIATVRFNF RSVGGSAGEF DHGVGEQDDL KAVAAWVRSQ RPDDRLWLAG       120
     FSFGSFVSLK AAAELQPEAL ISIAPPAGRW DFDGIAPPAR WLVIQGEQDE IVDPQAVYQW       180
     LDTLDFPHEL VRMPETSHFF HRKLIDLRGA LTHGVKHWLG AAA                         223
//

If you have problems or comments...

PBIL Back to PBIL home page