(data stored in ACNUC7421 zone)

EMBL: CP001111.PE205

CP001111.PE205       Location/Qualifiers
FT   CDS             complement(249846..250682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC0284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49910"
FT                   /db_xref="InterPro:IPR021307"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSM8"
FT                   /protein_id="ACF49910.1"
FT                   /translation="MRLSLPALALLPALFIAPALAAEGPELRSDQCGIHTDYDVLVDSG
FT                   GIWLRHGPQAPHEVVFHDGELSLDGRMVTVSTADAARLRQMETGARRLMPAATALAHEV
FT                   SGVTFDALDAAFEAITGKSRNRQMRAMRGEMQDWIDASLGRGYWEQEAFGDGFDAHIDQ
FT                   MAETMAGSMTRSVLWQVFTGRVGAMERRADRLDAEVDRRMEARSQQLEAKAMALCPLVQ
FT                   SLAEAHDALEVRYQGQPLRLLERGESVRVEHGNGSGLHVSAGPDERPRDNAVAPSR"
     MRLSLPALAL LPALFIAPAL AAEGPELRSD QCGIHTDYDV LVDSGGIWLR HGPQAPHEVV        60
     FHDGELSLDG RMVTVSTADA ARLRQMETGA RRLMPAATAL AHEVSGVTFD ALDAAFEAIT       120
     GKSRNRQMRA MRGEMQDWID ASLGRGYWEQ EAFGDGFDAH IDQMAETMAG SMTRSVLWQV       180
     FTGRVGAMER RADRLDAEVD RRMEARSQQL EAKAMALCPL VQSLAEAHDA LEVRYQGQPL       240
     RLLERGESVR VEHGNGSGLH VSAGPDERPR DNAVAPSR                               278
//

If you have problems or comments...

PBIL Back to PBIL home page