(data stored in ACNUC7421 zone)

EMBL: CP001111.PE208

CP001111.PE208       Location/Qualifiers
FT   CDS             complement(254976..255611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0208"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   ppg:PputGB1_2255 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49913"
FT                   /db_xref="GOA:B4SSN1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSN1"
FT                   /protein_id="ACF49913.1"
FT                   /translation="MPATSDLLAFALVSLAMVLTPGPNMIYVISRSICQGPVAGLISLG
FT                   GVALGFVFYMLCAALGITALLMTVPFAYDALRIGGALYLLYLAWQALKPGGRSPFAVRE
FT                   LPQDSPRKLFTMGFLTNLLNPKVAVMYLSLLPQFLHPDSEGSVLLQSVVLGSTQIAVSV
FT                   TVNGIIALTAGSIAGFLAARPTWQVVQRWLMGTVLAGLAVRMAVEGRR"
     MPATSDLLAF ALVSLAMVLT PGPNMIYVIS RSICQGPVAG LISLGGVALG FVFYMLCAAL        60
     GITALLMTVP FAYDALRIGG ALYLLYLAWQ ALKPGGRSPF AVRELPQDSP RKLFTMGFLT       120
     NLLNPKVAVM YLSLLPQFLH PDSEGSVLLQ SVVLGSTQIA VSVTVNGIIA LTAGSIAGFL       180
     AARPTWQVVQ RWLMGTVLAG LAVRMAVEGR R                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page