(data stored in ACNUC7421 zone)

EMBL: CP001111.PE209

CP001111.PE209       Location/Qualifiers
FT   CDS             255764..256165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0209"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   xcb:XC_4072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49914"
FT                   /db_xref="GOA:B4SSN2"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSN2"
FT                   /protein_id="ACF49914.1"
FT                   /translation="MTPIHETVPPTEVRMAEIVFPNHTNHLGTLFGGQALAWMDKAAFL
FT                   AAARYSRRTVVTARSDQVDFKLPIRIGQMVETIGRIVEVGRSSMKVEVELVAEDLHSGE
FT                   RKLCTRGHFVMIALDEEGHPIAVPPLPTA"
     MTPIHETVPP TEVRMAEIVF PNHTNHLGTL FGGQALAWMD KAAFLAAARY SRRTVVTARS        60
     DQVDFKLPIR IGQMVETIGR IVEVGRSSMK VEVELVAEDL HSGERKLCTR GHFVMIALDE       120
     EGHPIAVPPL PTA                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page