(data stored in ACNUC7421 zone)

EMBL: CP001111.PE212

CP001111.PE212       Location/Qualifiers
FT   CDS             complement(258286..259197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0212"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: xcb:XC_3052 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49917"
FT                   /db_xref="GOA:B4SSN5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSN5"
FT                   /protein_id="ACF49917.1"
FT                   /translation="MNLLQLIRSFTRTAETGSIAAAARILGISATAVGQNINRLEAHLG
FT                   VRLLNRSTRQLALSEAGALYLAQVRHIEADLARAQAMVTSGDIEPAGPLRIASSSAFGR
FT                   HVLAPLLPSLQQRYPQLQLELRLTDRAVQHGPEAVDASIRIGAQLEDGVVARQLARVPF
FT                   VFCASPAYLKAHGTPQQPSELSGHRGLLHRFPTDGRPLRWGLLKDGQRVDAALPPSMVC
FT                   DDIDALATLAVAGAGITRLAAFVAEPYLRDGRLQAVFGADSEWRPAPMEVYFCVSDRRD
FT                   FTAKIRALFEHLQAGMAPAWRV"
     MNLLQLIRSF TRTAETGSIA AAARILGISA TAVGQNINRL EAHLGVRLLN RSTRQLALSE        60
     AGALYLAQVR HIEADLARAQ AMVTSGDIEP AGPLRIASSS AFGRHVLAPL LPSLQQRYPQ       120
     LQLELRLTDR AVQHGPEAVD ASIRIGAQLE DGVVARQLAR VPFVFCASPA YLKAHGTPQQ       180
     PSELSGHRGL LHRFPTDGRP LRWGLLKDGQ RVDAALPPSM VCDDIDALAT LAVAGAGITR       240
     LAAFVAEPYL RDGRLQAVFG ADSEWRPAPM EVYFCVSDRR DFTAKIRALF EHLQAGMAPA       300
     WRV                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page