(data stored in ACNUC7421 zone)

EMBL: CP001111.PE216

CP001111.PE216       Location/Qualifiers
FT   CDS             262147..264021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0216"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: sme:SMc01492 probable
FT                   suppressor of E.COLI RpoH thermosensitive MUTATION
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49921"
FT                   /db_xref="GOA:B4SSN9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSN9"
FT                   /protein_id="ACF49921.1"
FT                   /translation="MAAKYCDLVMKGGITSGIVYPNAVLALAREYRFKSIGGTSAGAIA
FT                   AAVAAAAACGDRRQQAGEHLPGDAGYSGLSAVSAQLSRRGFIYSLFQPARGARAAYRLL
FT                   VVLTGNARLPHKLLCLAVAVFEIAPLEVLVSLSLLLGLGWWGGGWSGVAATLLPSLLCA
FT                   YGAGVAGAALRVARVARRNLLGLCSGLGRDARRPALTEWLHESLQQLSGKPLDAPLTFA
FT                   DLHDAPRYAGEPDSPHAISLQMITTCVSHNEPRTLPLGGAQFWFLREEFEQLFPASVVQ
FT                   WLVTQAGPPLEVEGRRYYHLPQGPKLPVLVATRMSLSFPLLISAVPLHEPSRRERRCEP
FT                   TAPAADQEHNVADSMEGLTSAGQTCGPVITAFRICWFSDGGISSNFPIHLFDAALPRWP
FT                   TFAINLVYPQHAEDVSHGSSGRQALEHAVFLPTENRHGWQRTYQSIATPLAAAELGRFL
FT                   FAVVATMQNWRDLLQARAPGYRDRIVHVSLQGDEGGMNLDMPQDVLTRIADKGSLAGAR
FT                   FCSFSFENHYWIRWRNLASAYQRYTLEVARTDDPAQQVLAYRAAYAMVASGQPAPPSYK
FT                   LGSEDKRLASQQLWGLMVEQGRSWDDLGPDLTDGAPRPLPQMKVTPIY"
     MAAKYCDLVM KGGITSGIVY PNAVLALARE YRFKSIGGTS AGAIAAAVAA AAACGDRRQQ        60
     AGEHLPGDAG YSGLSAVSAQ LSRRGFIYSL FQPARGARAA YRLLVVLTGN ARLPHKLLCL       120
     AVAVFEIAPL EVLVSLSLLL GLGWWGGGWS GVAATLLPSL LCAYGAGVAG AALRVARVAR       180
     RNLLGLCSGL GRDARRPALT EWLHESLQQL SGKPLDAPLT FADLHDAPRY AGEPDSPHAI       240
     SLQMITTCVS HNEPRTLPLG GAQFWFLREE FEQLFPASVV QWLVTQAGPP LEVEGRRYYH       300
     LPQGPKLPVL VATRMSLSFP LLISAVPLHE PSRRERRCEP TAPAADQEHN VADSMEGLTS       360
     AGQTCGPVIT AFRICWFSDG GISSNFPIHL FDAALPRWPT FAINLVYPQH AEDVSHGSSG       420
     RQALEHAVFL PTENRHGWQR TYQSIATPLA AAELGRFLFA VVATMQNWRD LLQARAPGYR       480
     DRIVHVSLQG DEGGMNLDMP QDVLTRIADK GSLAGARFCS FSFENHYWIR WRNLASAYQR       540
     YTLEVARTDD PAQQVLAYRA AYAMVASGQP APPSYKLGSE DKRLASQQLW GLMVEQGRSW       600
     DDLGPDLTDG APRPLPQMKV TPIY                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page