(data stored in ACNUC7421 zone)

EMBL: CP001111.PE22

CP001111.PE22        Location/Qualifiers
FT   CDS             26772..28865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0022"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: xcb:XC_0101 iron transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49727"
FT                   /db_xref="GOA:B4SR26"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR26"
FT                   /protein_id="ACF49727.1"
FT                   /translation="MNPAARRHCLPLSALLLSPLAAMAEPAPIALPAVQVQAARVPGID
FT                   PFALPASQDTVWIDAGRAGNSVQLSEALAGVPGLLARDRQNFAQDTQLSIRGFGARSTF
FT                   GVRGVRVLIDGVPATMPDGQGQLSHASLLGAERIEVLRGPFSALYGNSSGGVLQVWSAQ
FT                   GQASDPWRLRLNAGADNTLSIGAQLKGASHGLDYNIAANHFRTDGWREHSRARRESLTA
FT                   RIGGDLGGGRLELLLNALDAPDAQDPLGLTRAQVAADPRQATAVAHQYNTRKSVRQQQA
FT                   GLRWTRETDAQRWQLMGYAGQRAVRQYLPIPPAAQTNSPLHAGGVIDLEGGYGGLDARW
FT                   GWHGDLAGRPLDLVAGLSADRQRQHRTGYENFIGSALGVRGRLRRDQIDTVQNVDQFAQ
FT                   AWWQWSPRWSLLAGLRHSAVRFESDDRYITGRNPDDSGRRRYQATTPVAGVSFEASPQW
FT                   RLHAAVGRGFETPTFNELGYRADGQAGLALDLAAARSRNLEVGSKWHAQDGTQLDISLF
FT                   RADTDDELAVASNIGGRSTYRNIGRTRRQGVELQYRQPLAEQLELQLAWTWLQAQVRSP
FT                   YLTSNNVVAAGSRLPGVPRQQAFARLQWTPADWQWALEASASSDTVVNDVATERAPGYA
FT                   LLHVEGGRRWTLPGGELRAFARLENVLDQAYIGSVIVNDGNGRFYEPGPGRRASLGLQW
FT                   SWR"
     MNPAARRHCL PLSALLLSPL AAMAEPAPIA LPAVQVQAAR VPGIDPFALP ASQDTVWIDA        60
     GRAGNSVQLS EALAGVPGLL ARDRQNFAQD TQLSIRGFGA RSTFGVRGVR VLIDGVPATM       120
     PDGQGQLSHA SLLGAERIEV LRGPFSALYG NSSGGVLQVW SAQGQASDPW RLRLNAGADN       180
     TLSIGAQLKG ASHGLDYNIA ANHFRTDGWR EHSRARRESL TARIGGDLGG GRLELLLNAL       240
     DAPDAQDPLG LTRAQVAADP RQATAVAHQY NTRKSVRQQQ AGLRWTRETD AQRWQLMGYA       300
     GQRAVRQYLP IPPAAQTNSP LHAGGVIDLE GGYGGLDARW GWHGDLAGRP LDLVAGLSAD       360
     RQRQHRTGYE NFIGSALGVR GRLRRDQIDT VQNVDQFAQA WWQWSPRWSL LAGLRHSAVR       420
     FESDDRYITG RNPDDSGRRR YQATTPVAGV SFEASPQWRL HAAVGRGFET PTFNELGYRA       480
     DGQAGLALDL AAARSRNLEV GSKWHAQDGT QLDISLFRAD TDDELAVASN IGGRSTYRNI       540
     GRTRRQGVEL QYRQPLAEQL ELQLAWTWLQ AQVRSPYLTS NNVVAAGSRL PGVPRQQAFA       600
     RLQWTPADWQ WALEASASSD TVVNDVATER APGYALLHVE GGRRWTLPGG ELRAFARLEN       660
     VLDQAYIGSV IVNDGNGRFY EPGPGRRASL GLQWSWR                                697
//

If you have problems or comments...

PBIL Back to PBIL home page