(data stored in ACNUC7421 zone)

EMBL: CP001111.PE225

CP001111.PE225       Location/Qualifiers
FT   CDS             complement(273068..274180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0225"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   rpd:RPD_3086 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49930"
FT                   /db_xref="GOA:B4SSP8"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSP8"
FT                   /protein_id="ACF49930.1"
FT                   /translation="MCGKGQGGVITAGGRRYVGGAQSTGSGPTGVERLAGEGSETQRSM
FT                   APLYNHSMAADHTHFFDPATEQGVLRLSIAGALLLAAAAVVFGLLANSSLIIFDGIYGL
FT                   IDVVMTWLSLLVARLIALSTQTDALQSRLNQRFTMGFWHLEPIVLGVSGTLMIGAALYA
FT                   LVNAVDALMSGGRHIALGPAIIFAGLSLVAESALGWFVLRANRRIGSEFIALDAKNWVV
FT                   AASMSACYMVAFLGGVLVQGTSWAWVGPYIDPAILAFVCVLVMIAPLGTVRRALAGILL
FT                   VTPPELQAHVDAVARGIVAKHGFVEHRSYVAQVGRGEQIELFFVVPENDPPRPLVEWDQ
FT                   LRDEIGDALGEASPDRWLTIMFTTDREWTI"
     MCGKGQGGVI TAGGRRYVGG AQSTGSGPTG VERLAGEGSE TQRSMAPLYN HSMAADHTHF        60
     FDPATEQGVL RLSIAGALLL AAAAVVFGLL ANSSLIIFDG IYGLIDVVMT WLSLLVARLI       120
     ALSTQTDALQ SRLNQRFTMG FWHLEPIVLG VSGTLMIGAA LYALVNAVDA LMSGGRHIAL       180
     GPAIIFAGLS LVAESALGWF VLRANRRIGS EFIALDAKNW VVAASMSACY MVAFLGGVLV       240
     QGTSWAWVGP YIDPAILAFV CVLVMIAPLG TVRRALAGIL LVTPPELQAH VDAVARGIVA       300
     KHGFVEHRSY VAQVGRGEQI ELFFVVPEND PPRPLVEWDQ LRDEIGDALG EASPDRWLTI       360
     MFTTDREWTI                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page