(data stored in ACNUC7421 zone)

EMBL: CP001111.PE228

CP001111.PE228       Location/Qualifiers
FT   CDS             277727..278101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_0384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49933"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSQ1"
FT                   /protein_id="ACF49933.1"
FT                   /translation="MSSAPFHRRIALATCVVLAAAPLSSALAQQPPRGDQGRAEMMERG
FT                   ERGGRGDERSLSDAVRRVQRTTGGHILGAERVPFDGRDINRVKYMDDRGRVRYMDDPAP
FT                   SRSQPRTPRSDMSSLRGDNP"
     MSSAPFHRRI ALATCVVLAA APLSSALAQQ PPRGDQGRAE MMERGERGGR GDERSLSDAV        60
     RRVQRTTGGH ILGAERVPFD GRDINRVKYM DDRGRVRYMD DPAPSRSQPR TPRSDMSSLR       120
     GDNP                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page