(data stored in ACNUC7421 zone)

EMBL: CP001111.PE230

CP001111.PE230       Location/Qualifiers
FT   CDS             278881..280308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0230"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: xac:XAC4022 two-component
FT                   system sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49935"
FT                   /db_xref="GOA:B4ST92"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4ST92"
FT                   /protein_id="ACF49935.1"
FT                   /translation="MMSGRLWFFRRWRPRSLQARQMLAASVGLVAFLALAGYALDAAFA
FT                   DTAKANLRERLKNYATAYAAGIDFTRDRSLYIREQPPDSRFDVPGSGLYLQVVMPHGKG
FT                   NSMSAEGPMLPTVGGGLLAPRQEVFEGPLPMIQIDGSQGSVYRYGLGLVWDADADPATE
FT                   FPYTIYVMEDSRALGAQLRVFRGRVWFYLGGIGLILLLLQTVILQWSLRPLRRVITELT
FT                   KVQRGETARMSERHPRELEPLTDSINAFIESERENLERQRNTLADLAHSLKTPIAVLRT
FT                   QMDSGAGDGALREELDVQLQRMNNLVSYQLARAASSGHKLFSAPLPIESNAEEIVRGLE
FT                   KVYASKGVLCEFDIDPAARFHGEPGDLQELLGNLLENAFKWANRRVLLTAQPLPAPNAR
FT                   RAGLLLAVDDDGPGIAPDDIGKVLQRGVRGDERVQGHGIGLSIVQDLIKDYRGELTVGR
FT                   SSELGGARFEVQLPPGP"
     MMSGRLWFFR RWRPRSLQAR QMLAASVGLV AFLALAGYAL DAAFADTAKA NLRERLKNYA        60
     TAYAAGIDFT RDRSLYIREQ PPDSRFDVPG SGLYLQVVMP HGKGNSMSAE GPMLPTVGGG       120
     LLAPRQEVFE GPLPMIQIDG SQGSVYRYGL GLVWDADADP ATEFPYTIYV MEDSRALGAQ       180
     LRVFRGRVWF YLGGIGLILL LLQTVILQWS LRPLRRVITE LTKVQRGETA RMSERHPREL       240
     EPLTDSINAF IESERENLER QRNTLADLAH SLKTPIAVLR TQMDSGAGDG ALREELDVQL       300
     QRMNNLVSYQ LARAASSGHK LFSAPLPIES NAEEIVRGLE KVYASKGVLC EFDIDPAARF       360
     HGEPGDLQEL LGNLLENAFK WANRRVLLTA QPLPAPNARR AGLLLAVDDD GPGIAPDDIG       420
     KVLQRGVRGD ERVQGHGIGL SIVQDLIKDY RGELTVGRSS ELGGARFEVQ LPPGP            475
//

If you have problems or comments...

PBIL Back to PBIL home page