(data stored in ACNUC7421 zone)

EMBL: CP001111.PE231

CP001111.PE231       Location/Qualifiers
FT   CDS             complement(280402..281190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0231"
FT                   /product="protein of unknown function DUF980"
FT                   /note="PFAM: protein of unknown function DUF980; KEGG:
FT                   xcv:XCV4112 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49936"
FT                   /db_xref="GOA:B4ST93"
FT                   /db_xref="InterPro:IPR010384"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042252"
FT                   /db_xref="UniProtKB/TrEMBL:B4ST93"
FT                   /protein_id="ACF49936.1"
FT                   /translation="MAQLPAGNVPLIKSLLQWLRPAPRPIDNALWDDACRRAAWLHGLD
FT                   DERRARLRVLATRFLHEKTITPIGELQLQAGDGVLLAALCCLPLLEFGEVGLEGWSQLI
FT                   VYPDAFRVHRSHMDAAGVLHEWDDELIGESWDSGPLILSWADVQADLAAPHEGYCVAVH
FT                   EMVHKLDALDGAMDGTPPLPREWQREWAATFQRAYDAFCVQVDAGEETLIDPYAAEAPE
FT                   EFFAVASEYHFSAPDLLQQALPEVAAQLRRFYGEPPKMVD"
     MAQLPAGNVP LIKSLLQWLR PAPRPIDNAL WDDACRRAAW LHGLDDERRA RLRVLATRFL        60
     HEKTITPIGE LQLQAGDGVL LAALCCLPLL EFGEVGLEGW SQLIVYPDAF RVHRSHMDAA       120
     GVLHEWDDEL IGESWDSGPL ILSWADVQAD LAAPHEGYCV AVHEMVHKLD ALDGAMDGTP       180
     PLPREWQREW AATFQRAYDA FCVQVDAGEE TLIDPYAAEA PEEFFAVASE YHFSAPDLLQ       240
     QALPEVAAQL RRFYGEPPKM VD                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page