(data stored in ACNUC7421 zone)

EMBL: CP001111.PE234

CP001111.PE234       Location/Qualifiers
FT   CDS             282551..283282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0234"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: xcb:XC_4025 pantothenate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49939"
FT                   /db_xref="GOA:B4ST96"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4ST96"
FT                   /protein_id="ACF49939.1"
FT                   /translation="MSDWLFDLGNSRFKFAPLQGDRAGDVQAWAHGAEGMAGQPPHSLP
FT                   SGTTAFVASVAAPSLTSAMLDQLQRRFEHVHVVRTSAECAGVRIAYAKPEKFGVDRFLA
FT                   LLAAAKAQRPVLVVGVGTALTIDLLDANGQHHGGRISASPTTMREALHARAVQLPATGG
FT                   DYSEFANDTADALASGCDGAAVALIERSAQQAHALLGVAPSLLVHGGGAPALMPLLPGA
FT                   DYHPSLVLDGLARWAVHQPAG"
     MSDWLFDLGN SRFKFAPLQG DRAGDVQAWA HGAEGMAGQP PHSLPSGTTA FVASVAAPSL        60
     TSAMLDQLQR RFEHVHVVRT SAECAGVRIA YAKPEKFGVD RFLALLAAAK AQRPVLVVGV       120
     GTALTIDLLD ANGQHHGGRI SASPTTMREA LHARAVQLPA TGGDYSEFAN DTADALASGC       180
     DGAAVALIER SAQQAHALLG VAPSLLVHGG GAPALMPLLP GADYHPSLVL DGLARWAVHQ       240
     PAG                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page