(data stored in ACNUC7421 zone)

EMBL: CP001111.PE235

CP001111.PE235       Location/Qualifiers
FT   CDS             283292..284140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0235"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: xac:XAC4016
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49940"
FT                   /db_xref="GOA:B4ST97"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B4ST97"
FT                   /protein_id="ACF49940.1"
FT                   /translation="MLTRALIVVLAILNLGVACWWLLRDAPQPPAPPPQPAGVAELRWV
FT                   PGGVDATAAAEASAAAPTAPLMEREPAAKTAVAATPAPATPAQPEVAKPQVAEATPVAA
FT                   AAKPGTPPAPAPAPEKPVTPPVAAEPPRCIALGPFADRAAATSAQGKASTVLSQVRLRE
FT                   QPAASGSARFRVMLPAAANREEAQATVKRIVAAGLSDYYIISQGEDINAVALGQYRNRE
FT                   GAERRMAAVQAAGFQPRLVASGDAGQWWLEGQLAAGTQPAQAQQRSGAAQSRSLECTRL
FT                   R"
     MLTRALIVVL AILNLGVACW WLLRDAPQPP APPPQPAGVA ELRWVPGGVD ATAAAEASAA        60
     APTAPLMERE PAAKTAVAAT PAPATPAQPE VAKPQVAEAT PVAAAAKPGT PPAPAPAPEK       120
     PVTPPVAAEP PRCIALGPFA DRAAATSAQG KASTVLSQVR LREQPAASGS ARFRVMLPAA       180
     ANREEAQATV KRIVAAGLSD YYIISQGEDI NAVALGQYRN REGAERRMAA VQAAGFQPRL       240
     VASGDAGQWW LEGQLAAGTQ PAQAQQRSGA AQSRSLECTR LR                          282
//

If you have problems or comments...

PBIL Back to PBIL home page