(data stored in ACNUC7421 zone)

EMBL: CP001111.PE237

CP001111.PE237       Location/Qualifiers
FT   CDS             284786..285088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0237"
FT                   /product="putative transcriptional regulator"
FT                   /note="TIGRFAM: addiction module antidote protein; PFAM:
FT                   helix-turn-helix domain protein; KEGG: noc:Noc_0569
FT                   transcriptional regulator, Cro/CI family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49942"
FT                   /db_xref="GOA:B4ST99"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:B4ST99"
FT                   /protein_id="ACF49942.1"
FT                   /translation="MVIKKKVELKAFDVAEHLRTPEEMAAYLDACIEESDGDSAFIAKA
FT                   LGDIARAQGMSKVARAAGLSRESLYRALSGERSPDFATILKVTRALGVRLHASAA"
     MVIKKKVELK AFDVAEHLRT PEEMAAYLDA CIEESDGDSA FIAKALGDIA RAQGMSKVAR        60
     AAGLSRESLY RALSGERSPD FATILKVTRA LGVRLHASAA                             100
//

If you have problems or comments...

PBIL Back to PBIL home page