(data stored in ACNUC7421 zone)

EMBL: CP001111.PE24

CP001111.PE24        Location/Qualifiers
FT   CDS             29586..29984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV0108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49729"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR28"
FT                   /protein_id="ACF49729.1"
FT                   /translation="MPRLERPAPSVFNALLDPLGQRTAQRRTRRHEDPQAVAQDYLQYM
FT                   LSDYEERRGQSHRNWRDLCPVYAFALTTHAADWPRGDAADTCEELAEHWEQMRGHSRLS
FT                   WSQARPVVEDAWRALDHIPAAAVRPLLQ"
     MPRLERPAPS VFNALLDPLG QRTAQRRTRR HEDPQAVAQD YLQYMLSDYE ERRGQSHRNW        60
     RDLCPVYAFA LTTHAADWPR GDAADTCEEL AEHWEQMRGH SRLSWSQARP VVEDAWRALD       120
     HIPAAAVRPL LQ                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page