(data stored in ACNUC7421 zone)

EMBL: CP001111.PE247

CP001111.PE247       Location/Qualifiers
FT   CDS             complement(293589..294923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0247"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: xcb:XC_4259
FT                   dicarboxylate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49952"
FT                   /db_xref="GOA:B4STA9"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4STA9"
FT                   /protein_id="ACF49952.1"
FT                   /translation="MSTTSHSAVPSTDGAALRRSISNTLKGSAGNLVEWYDVYVYSVFA
FT                   VYFESQFFSPDDKNSTMYVWAIFAATFLMRPIGAWFFGRFADRHGRRQALTVSVTLMAA
FT                   CSFLIAITPTAASIGIWAAVILLFARLLQGFATGGEYGASATYMSEAAIPGRRGFLSSF
FT                   HYVTLVGGHVLAQLTLLLMLTFWGKPEISEWGWRIAFGIGGIAAVVVFWLRRGMDESLS
FT                   ESSIEAAREGKAQKSGSMYELFVHQWRPLLLCFLITAGGTVAFYTYSVNGPKMIQSAFA
FT                   ANDPMTGTLINLGVLAFLMVLQPVGGWLSDIIGRKTLLVFFGVGGVLYSWYLITQLPHQ
FT                   HDATLAFLTLALGFVILTGYTSINAVVKAELFPTHVRALGVGLGYALANSLFGGTAPLL
FT                   YQGALKTGHVDWFAIYVTATIAVSLVVYVFFLTNKGPNWLDGTRK"
     MSTTSHSAVP STDGAALRRS ISNTLKGSAG NLVEWYDVYV YSVFAVYFES QFFSPDDKNS        60
     TMYVWAIFAA TFLMRPIGAW FFGRFADRHG RRQALTVSVT LMAACSFLIA ITPTAASIGI       120
     WAAVILLFAR LLQGFATGGE YGASATYMSE AAIPGRRGFL SSFHYVTLVG GHVLAQLTLL       180
     LMLTFWGKPE ISEWGWRIAF GIGGIAAVVV FWLRRGMDES LSESSIEAAR EGKAQKSGSM       240
     YELFVHQWRP LLLCFLITAG GTVAFYTYSV NGPKMIQSAF AANDPMTGTL INLGVLAFLM       300
     VLQPVGGWLS DIIGRKTLLV FFGVGGVLYS WYLITQLPHQ HDATLAFLTL ALGFVILTGY       360
     TSINAVVKAE LFPTHVRALG VGLGYALANS LFGGTAPLLY QGALKTGHVD WFAIYVTATI       420
     AVSLVVYVFF LTNKGPNWLD GTRK                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page