(data stored in ACNUC7421 zone)

EMBL: CP001111.PE248

CP001111.PE248       Location/Qualifiers
FT   CDS             295236..296141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0248"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: xac:XAC4003 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49953"
FT                   /db_xref="GOA:B4STB0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B4STB0"
FT                   /protein_id="ACF49953.1"
FT                   /translation="MSAPPVPSAAAPRGGLVALALLLVYVVWGSTYLGIAKALHGGALP
FT                   LTMVSGSRFIIAGGLMFLALRLFWKMPNPTLRQWRNLVIMGVTMLVLGNGMVVLAEREV
FT                   SSGLAATAVASVPLWMALFSALRGQHASKGEWLGIAVGFVGVVWLNAGSSLTASPTGLV
FT                   LLLIAPIGWAFGSVWARGLDLPGPFMTAAGQMLCGGVLLVLIGLAVGERPTTLPDTGGL
FT                   LAMAYLCVFGSIVAFTAYVWLLQNVRPALAGSYAYVNPVIAVLLGAALNGERFGWRDFL
FT                   AMAVILLGVVVLTMARTRKK"
     MSAPPVPSAA APRGGLVALA LLLVYVVWGS TYLGIAKALH GGALPLTMVS GSRFIIAGGL        60
     MFLALRLFWK MPNPTLRQWR NLVIMGVTML VLGNGMVVLA EREVSSGLAA TAVASVPLWM       120
     ALFSALRGQH ASKGEWLGIA VGFVGVVWLN AGSSLTASPT GLVLLLIAPI GWAFGSVWAR       180
     GLDLPGPFMT AAGQMLCGGV LLVLIGLAVG ERPTTLPDTG GLLAMAYLCV FGSIVAFTAY       240
     VWLLQNVRPA LAGSYAYVNP VIAVLLGAAL NGERFGWRDF LAMAVILLGV VVLTMARTRK       300
     K                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page