(data stored in ACNUC7421 zone)

EMBL: CP001111.PE250

CP001111.PE250       Location/Qualifiers
FT   CDS             complement(297266..300124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0250"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: xcv:XCV3187 TonB-dependent outer
FT                   membrane receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49955"
FT                   /db_xref="GOA:B4STB2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:B4STB2"
FT                   /protein_id="ACF49955.1"
FT                   /translation="MSLKTNPLRNAIVIALAASCTTPAFAQSAGDTPTNLDRIEITGSR
FT                   IRQASVETAQPVVALSRAEIEKKGYINVADILQDVTAAGAPSLSRSSSLSSSRDFGGTY
FT                   VSLRNLGPERSLVLIDGRRMGVSAGGYSDLASIPSAIVERVEVLTDGASALYGSDAIAG
FT                   VVNIITRKNFDGGEASVYVGQYGEGDGQKRSYSATFGKTFDRGWFSVGAERTKEDEILG
FT                   SEREFSRYPGGPRHPDDVKALNQTTQWGSVTVDGKSLTVGPGGDPSQKGNFHTPDPADG
FT                   ANTKTNMSLLSGMERTSVFANGGFSITDDLRIVADALYSKRESTKHLAGYPYSVSTAQA
FT                   RNGSRAALSKDSAFNHWGQDVLFSHRTEEMPRATENNLDTKRASIGLEGSFETGSRYWD
FT                   WNVSYMYNRNEGERIGTGSMYQPHVDLAVGPSFMDGTVARCGSPGAVIAGCVPWNPAAP
FT                   MGYAGPGSLSNQDVQDYLFTRFVDKMKSTTKVASANISGSVFSLPAGDVMAAMGFEHRS
FT                   EEASYTPDLMVQKGQIAGTTGQPTRGDYSLNEVYLELQVPLLADMPFARELSLDLAGRY
FT                   TDYNTFGSTTNSKFGLKWKPIDSLLVRATYGTGFRAPTVDDLYSGGAKSRDSFTDPCDT
FT                   SFGIAASSATVAARCQALKVPANFRQQTASEGNVANRPGQQGIADFDSGSNANLKPETA
FT                   KTWTVGLVYSPEFVPGLDVSLDWWKIRIDNAIVGESATDILNQCYVQGVDSACGRFTRS
FT                   TSAKTLGQVTALDRSLVNAGYRETAGYDFSLRYRLPETSFGRFAATWNTTYTDYLEQRN
FT                   DSAATTPVEQKTGWQGNFRVRSTFNLDWQYGDLGIGWTARYYSGMKEACSYDLGGGPDC
FT                   NMAGFVSPYTDAQPSRKVGSNTFHDLQVRYSLPWDGTVSLGVNNVFDHQGPIMYSQPNS
FT                   SFTYYGGFDIGRFMYMKYQQRF"
     MSLKTNPLRN AIVIALAASC TTPAFAQSAG DTPTNLDRIE ITGSRIRQAS VETAQPVVAL        60
     SRAEIEKKGY INVADILQDV TAAGAPSLSR SSSLSSSRDF GGTYVSLRNL GPERSLVLID       120
     GRRMGVSAGG YSDLASIPSA IVERVEVLTD GASALYGSDA IAGVVNIITR KNFDGGEASV       180
     YVGQYGEGDG QKRSYSATFG KTFDRGWFSV GAERTKEDEI LGSEREFSRY PGGPRHPDDV       240
     KALNQTTQWG SVTVDGKSLT VGPGGDPSQK GNFHTPDPAD GANTKTNMSL LSGMERTSVF       300
     ANGGFSITDD LRIVADALYS KRESTKHLAG YPYSVSTAQA RNGSRAALSK DSAFNHWGQD       360
     VLFSHRTEEM PRATENNLDT KRASIGLEGS FETGSRYWDW NVSYMYNRNE GERIGTGSMY       420
     QPHVDLAVGP SFMDGTVARC GSPGAVIAGC VPWNPAAPMG YAGPGSLSNQ DVQDYLFTRF       480
     VDKMKSTTKV ASANISGSVF SLPAGDVMAA MGFEHRSEEA SYTPDLMVQK GQIAGTTGQP       540
     TRGDYSLNEV YLELQVPLLA DMPFARELSL DLAGRYTDYN TFGSTTNSKF GLKWKPIDSL       600
     LVRATYGTGF RAPTVDDLYS GGAKSRDSFT DPCDTSFGIA ASSATVAARC QALKVPANFR       660
     QQTASEGNVA NRPGQQGIAD FDSGSNANLK PETAKTWTVG LVYSPEFVPG LDVSLDWWKI       720
     RIDNAIVGES ATDILNQCYV QGVDSACGRF TRSTSAKTLG QVTALDRSLV NAGYRETAGY       780
     DFSLRYRLPE TSFGRFAATW NTTYTDYLEQ RNDSAATTPV EQKTGWQGNF RVRSTFNLDW       840
     QYGDLGIGWT ARYYSGMKEA CSYDLGGGPD CNMAGFVSPY TDAQPSRKVG SNTFHDLQVR       900
     YSLPWDGTVS LGVNNVFDHQ GPIMYSQPNS SFTYYGGFDI GRFMYMKYQQ RF               952
//

If you have problems or comments...

PBIL Back to PBIL home page