(data stored in ACNUC7421 zone)

EMBL: CP001111.PE252

CP001111.PE252       Location/Qualifiers
FT   CDS             complement(301831..302988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0252"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   xom:XOO_0137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49957"
FT                   /db_xref="GOA:B4STB4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B4STB4"
FT                   /protein_id="ACF49957.1"
FT                   /translation="MKYFSLVWAQLFRTRTRTLLTLLSVVAAFLLFGMLDSVRVAFTSG
FT                   GSVEGANRLVTASRLSITQSLPIRLETQIRQVAGVRDVAYGMWFGGIYQDPKNFFPNFS
FT                   VSPNYFDVYRELQIDPAQLEDWKNTRTGAIVGETLAKQFGWKIGDTIPLQATIFPRGGS
FT                   NDWPLELKGIYRSRDPAQASNEERQLMMNWKYFDESNDYIKNQVSWYTVTLDNPDHSSR
FT                   VAQAIDAISANSDHETKTQTESAFQQAFVKQFADIGMIVTSIMGAVFFTLLLLTGNTMA
FT                   QAVRERVPELATLKTLGFKDSTVLMLVMVESVLLIGLGGLIGMGLAALILPAIGPKSMG
FT                   MLPPHVPTPTWLMGLGLIVVIGIIVGLLPALRAKRLKIVDALAGR"
     MKYFSLVWAQ LFRTRTRTLL TLLSVVAAFL LFGMLDSVRV AFTSGGSVEG ANRLVTASRL        60
     SITQSLPIRL ETQIRQVAGV RDVAYGMWFG GIYQDPKNFF PNFSVSPNYF DVYRELQIDP       120
     AQLEDWKNTR TGAIVGETLA KQFGWKIGDT IPLQATIFPR GGSNDWPLEL KGIYRSRDPA       180
     QASNEERQLM MNWKYFDESN DYIKNQVSWY TVTLDNPDHS SRVAQAIDAI SANSDHETKT       240
     QTESAFQQAF VKQFADIGMI VTSIMGAVFF TLLLLTGNTM AQAVRERVPE LATLKTLGFK       300
     DSTVLMLVMV ESVLLIGLGG LIGMGLAALI LPAIGPKSMG MLPPHVPTPT WLMGLGLIVV       360
     IGIIVGLLPA LRAKRLKIVD ALAGR                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page