(data stored in ACNUC7421 zone)

EMBL: CP001111.PE254

CP001111.PE254       Location/Qualifiers
FT   CDS             complement(303795..305048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0254"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   xcv:XCV4088 membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49959"
FT                   /db_xref="GOA:B4STB6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B4STB6"
FT                   /protein_id="ACF49959.1"
FT                   /translation="MNASAELLKELRIDRKSPPPASGGSGSGGGRRWLWIAIIVIVLLL
FT                   AAAAFALFGRTPAVDVETAPAVAIQQGNASSSVLDASGYVVARRMATVSAKITGKVREV
FT                   MIEEGMRVEQGQIMATLDPIDADAQRSLYASQLQAARSQVAGLEAQQKQAAAEASRLQA
FT                   LVGQQLVSRSQYDQAVAQRDSLRAQLDTAQRNVKVANDQLAIADLGVDNNIVRAPFSGV
FT                   VTAKAAQPGEIVSPLSAGGGFTRTGIGTIVDMESLEIEVEVGEAFIGRVQPKMPVEATL
FT                   NAYPEWKIPGEVIAIIPTADRGKATVKVRVALKVKDPRIVPEMGVRVSFLEQAQPQAAA
FT                   KPQGVRVPGGAVVQREGTSVAFVLGDESRVQQRTVEAGQAMGKDRQILKGVSAGESVVV
FT                   NPPDTLRDGAKVQQKQAQ"
     MNASAELLKE LRIDRKSPPP ASGGSGSGGG RRWLWIAIIV IVLLLAAAAF ALFGRTPAVD        60
     VETAPAVAIQ QGNASSSVLD ASGYVVARRM ATVSAKITGK VREVMIEEGM RVEQGQIMAT       120
     LDPIDADAQR SLYASQLQAA RSQVAGLEAQ QKQAAAEASR LQALVGQQLV SRSQYDQAVA       180
     QRDSLRAQLD TAQRNVKVAN DQLAIADLGV DNNIVRAPFS GVVTAKAAQP GEIVSPLSAG       240
     GGFTRTGIGT IVDMESLEIE VEVGEAFIGR VQPKMPVEAT LNAYPEWKIP GEVIAIIPTA       300
     DRGKATVKVR VALKVKDPRI VPEMGVRVSF LEQAQPQAAA KPQGVRVPGG AVVQREGTSV       360
     AFVLGDESRV QQRTVEAGQA MGKDRQILKG VSAGESVVVN PPDTLRDGAK VQQKQAQ          417
//

If you have problems or comments...

PBIL Back to PBIL home page