(data stored in ACNUC7421 zone)

EMBL: CP001111.PE255

CP001111.PE255       Location/Qualifiers
FT   CDS             305251..306147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0255"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ccr:CC_1147 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49960"
FT                   /db_xref="GOA:B4STB7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4STB7"
FT                   /protein_id="ACF49960.1"
FT                   /translation="MDPIAPSLARLQQVQVRYRDHTALHGIDLQVRAGQVLALLGRNGA
FT                   GKSTAISVLLGLRRADGGQVELLGGDPQQRTSRLGLGVMLQSTSLPPMLQVDELVAQAS
FT                   ACYPDPMPLQEVLQRAGLQALARRRYGQLSGGQQRAVQFAIALCGRPRVLFLDEPTTGL
FT                   DIQARRVMWQAIRQLVAEGCGVLLTTHYLEEAEALAQQVVVLEQGRVLADAPLSELRLA
FT                   DRPRRIRCRSGLPMEDVQQWPGVQEVQRDGEHLQLLASPAEPVVARLLAADAQLRELEV
FT                   QGAALADAFLDMTREAA"
     MDPIAPSLAR LQQVQVRYRD HTALHGIDLQ VRAGQVLALL GRNGAGKSTA ISVLLGLRRA        60
     DGGQVELLGG DPQQRTSRLG LGVMLQSTSL PPMLQVDELV AQASACYPDP MPLQEVLQRA       120
     GLQALARRRY GQLSGGQQRA VQFAIALCGR PRVLFLDEPT TGLDIQARRV MWQAIRQLVA       180
     EGCGVLLTTH YLEEAEALAQ QVVVLEQGRV LADAPLSELR LADRPRRIRC RSGLPMEDVQ       240
     QWPGVQEVQR DGEHLQLLAS PAEPVVARLL AADAQLRELE VQGAALADAF LDMTREAA         298
//

If you have problems or comments...

PBIL Back to PBIL home page