(data stored in ACNUC7421 zone)

EMBL: CP001111.PE26

CP001111.PE26        Location/Qualifiers
FT   CDS             31048..33525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0026"
FT                   /product="DNA ligase D"
FT                   /note="TIGRFAM: DNA ligase D; DNA ligase D,
FT                   3'-phosphoesterase domain protein; DNA polymerase LigD,
FT                   polymerase domain protein; DNA polymerase LigD, ligase
FT                   domain protein; PFAM: DNA primase small subunit; ATP
FT                   dependent DNA ligase domain protein; ATP dependent DNA
FT                   ligase; KEGG: xcb:XC_1808 ATP-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49731"
FT                   /db_xref="GOA:B4SR30"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014143"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR033651"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR30"
FT                   /protein_id="ACF49731.1"
FT                   /translation="MSLHQYRRKRRLGGGAGQTPEPDDTPARGDPKRRPTFVIQLHHAS
FT                   SRHYDFRLEMDGVLKSWAVPKGPSLRVGEKRLAVEVEDHPLSYAGFEGDIPEGHYGAGH
FT                   VDVFDHGTWACEGDPLQALAAGKIDFVLHGQRLAGGWKLVRTAMKGRQVQWLLIKRDDG
FT                   EARDAEADDLLTAPMPKRAPAAKKRSVERAAAAARTTTRKADARWHARALKLDGARDTP
FT                   YPRAFKPQLTDHRDSAPDGARWLHEIKWDGYRLLADLHDGEVKLRSRNGLDWTDDFPEL
FT                   VQAVLALPVRDARLDGELVVLDPDGRSDFAALQRVIDGSSKQPLRYIVFDLPGVAGVDI
FT                   SRVPLLERKALLKDLIGPAPGTLAFSEHVIDHGPQVFDASGGAGFEGIVSKQVDAPYVN
FT                   TRARSWVKVKHEDTDEFVIVGHTAPKGSRVGFGSLLLATPDKAGLRYVGRVGTGFDDDS
FT                   LRALLKALQPLAVNAPVLQLPAHVPFRAASVRWVKPVTVAEVAFRGWGKEGLLRQASFK
FT                   RLRSDKQKEDLGMSTADTEAGGEVQITHPERVVFPKEKLSKGDVADYYQRVARWILPEL
FT                   AGRPLSLLRCPDGVGRACFFQKHHGPGLGDAVHAVPLQQKSGREDYVYIDDARGLLQLV
FT                   QMNTLELHPWGATVIDPEHPDRLVFDLDPGEGVSWAQVKAGARDVRDRLQQVGLKSFVR
FT                   LSGGKGVHVVVPMQPKAGWDEAKAFCEAFAQAMALEQPDRYVATMSKAKRNGVIFIDWL
FT                   RNTRGATSVCSWSLRARDGAGVAVPLRWEELARVSAADAFPMAKALARAKRLKGDPWQG
FT                   IERLKQTLPSLKR"
     MSLHQYRRKR RLGGGAGQTP EPDDTPARGD PKRRPTFVIQ LHHASSRHYD FRLEMDGVLK        60
     SWAVPKGPSL RVGEKRLAVE VEDHPLSYAG FEGDIPEGHY GAGHVDVFDH GTWACEGDPL       120
     QALAAGKIDF VLHGQRLAGG WKLVRTAMKG RQVQWLLIKR DDGEARDAEA DDLLTAPMPK       180
     RAPAAKKRSV ERAAAAARTT TRKADARWHA RALKLDGARD TPYPRAFKPQ LTDHRDSAPD       240
     GARWLHEIKW DGYRLLADLH DGEVKLRSRN GLDWTDDFPE LVQAVLALPV RDARLDGELV       300
     VLDPDGRSDF AALQRVIDGS SKQPLRYIVF DLPGVAGVDI SRVPLLERKA LLKDLIGPAP       360
     GTLAFSEHVI DHGPQVFDAS GGAGFEGIVS KQVDAPYVNT RARSWVKVKH EDTDEFVIVG       420
     HTAPKGSRVG FGSLLLATPD KAGLRYVGRV GTGFDDDSLR ALLKALQPLA VNAPVLQLPA       480
     HVPFRAASVR WVKPVTVAEV AFRGWGKEGL LRQASFKRLR SDKQKEDLGM STADTEAGGE       540
     VQITHPERVV FPKEKLSKGD VADYYQRVAR WILPELAGRP LSLLRCPDGV GRACFFQKHH       600
     GPGLGDAVHA VPLQQKSGRE DYVYIDDARG LLQLVQMNTL ELHPWGATVI DPEHPDRLVF       660
     DLDPGEGVSW AQVKAGARDV RDRLQQVGLK SFVRLSGGKG VHVVVPMQPK AGWDEAKAFC       720
     EAFAQAMALE QPDRYVATMS KAKRNGVIFI DWLRNTRGAT SVCSWSLRAR DGAGVAVPLR       780
     WEELARVSAA DAFPMAKALA RAKRLKGDPW QGIERLKQTL PSLKR                       825
//

If you have problems or comments...

PBIL Back to PBIL home page