(data stored in ACNUC7421 zone)

EMBL: CP001111.PE260

CP001111.PE260       Location/Qualifiers
FT   CDS             complement(309882..310985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0260"
FT                   /product="Catalase domain protein"
FT                   /note="PFAM: Catalase domain protein; KEGG: xac:XAC3990
FT                   catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49965"
FT                   /db_xref="GOA:B4STC2"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024168"
FT                   /db_xref="UniProtKB/TrEMBL:B4STC2"
FT                   /protein_id="ACF49965.1"
FT                   /translation="MSLFRYTRAGQTPGAPRKHSPLLWIALIALILGAVALAFAWLAGW
FT                   IGGRLTAQRFTDTIEATGPAHPGFRRAHSKGICVSGWFEPSSQAPTLSSARVFSQQKVP
FT                   VMGRLSIGGGDPYGADNTARVRSLAVQMVSDDGQEWRMAMNSFPFFAAPNAEAFYEQTR
FT                   ASIPDPATGKPDPQKMAAVLAKYPSAQAFQQWAKTAPWTSSWADTTFNSVNSFWFTNVQ
FT                   GQKRAVRWRWQPQAPVVEMDADTRKKASVDFLSQELQQRLASGPVRWNLVVTTAEPGDA
FT                   IDDPSVPWPESREQVVAGVLSLDRLQSQEQGACGQINFDPLILPSGVRGSDDPILAARS
FT                   AVYSQSFNRRERERASGNVEQPKEAAR"
     MSLFRYTRAG QTPGAPRKHS PLLWIALIAL ILGAVALAFA WLAGWIGGRL TAQRFTDTIE        60
     ATGPAHPGFR RAHSKGICVS GWFEPSSQAP TLSSARVFSQ QKVPVMGRLS IGGGDPYGAD       120
     NTARVRSLAV QMVSDDGQEW RMAMNSFPFF AAPNAEAFYE QTRASIPDPA TGKPDPQKMA       180
     AVLAKYPSAQ AFQQWAKTAP WTSSWADTTF NSVNSFWFTN VQGQKRAVRW RWQPQAPVVE       240
     MDADTRKKAS VDFLSQELQQ RLASGPVRWN LVVTTAEPGD AIDDPSVPWP ESREQVVAGV       300
     LSLDRLQSQE QGACGQINFD PLILPSGVRG SDDPILAARS AVYSQSFNRR ERERASGNVE       360
     QPKEAAR                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page