(data stored in ACNUC7421 zone)

EMBL: CP001111.PE261

CP001111.PE261       Location/Qualifiers
FT   CDS             complement(311121..312488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0261"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="PFAM: peptidase M17 leucyl aminopeptidase domain
FT                   protein; KEGG: xcb:XC_3992 leucine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49966"
FT                   /db_xref="GOA:B4STC3"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:B4STC3"
FT                   /protein_id="ACF49966.1"
FT                   /translation="MSEITGFTADTAAALPLHVLGREQFAAWKDGQPAATQAWLASQGF
FT                   NAGAHSVALLPGADGLAGAVIGVGDRADAYSYAHAPHALPEGSVWQLATELPAEEQALL
FT                   QLGWGLGSYRFDRYRKRNRAPAQLVAAPSGEVADLIAASLRVRDWVNTPTEDMGPQQLE
FT                   DAARALAQAHGAQVEAITGDELLKQNFPAIHAVGRASHRAPRMVVLRWGKETDPALVLV
FT                   GKGVCFDTGGLDIKPADGMRNMKKDMGGAAHALALAGLVMARRLPVHLTLLVPAVENAI
FT                   GPDAFRPGEVIATRKGLSVEIDNTDAEGRVILCDALTFASEQKPDLVLDFATLTGAARI
FT                   ALGPDLPALFSNDDAVAQQWLQAGDATRDPVWRMPLWRPYLRYLSSGIADLANAGSRMA
FT                   GSVTAALYLERFLEDGQRWAHLDVYAWNDGERPGRPAGGEALALRSAWAMLKARYS"
     MSEITGFTAD TAAALPLHVL GREQFAAWKD GQPAATQAWL ASQGFNAGAH SVALLPGADG        60
     LAGAVIGVGD RADAYSYAHA PHALPEGSVW QLATELPAEE QALLQLGWGL GSYRFDRYRK       120
     RNRAPAQLVA APSGEVADLI AASLRVRDWV NTPTEDMGPQ QLEDAARALA QAHGAQVEAI       180
     TGDELLKQNF PAIHAVGRAS HRAPRMVVLR WGKETDPALV LVGKGVCFDT GGLDIKPADG       240
     MRNMKKDMGG AAHALALAGL VMARRLPVHL TLLVPAVENA IGPDAFRPGE VIATRKGLSV       300
     EIDNTDAEGR VILCDALTFA SEQKPDLVLD FATLTGAARI ALGPDLPALF SNDDAVAQQW       360
     LQAGDATRDP VWRMPLWRPY LRYLSSGIAD LANAGSRMAG SVTAALYLER FLEDGQRWAH       420
     LDVYAWNDGE RPGRPAGGEA LALRSAWAML KARYS                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page