(data stored in ACNUC7421 zone)

EMBL: CP001111.PE267

CP001111.PE267       Location/Qualifiers
FT   CDS             complement(315830..317263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0267"
FT                   /product="protease Do"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: xcv:XCV4074 protease DO precursor; TIGRFAM:
FT                   protease Do; PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49972"
FT                   /db_xref="GOA:B4STC9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B4STC9"
FT                   /protein_id="ACF49972.1"
FT                   /translation="MRPLPTLLTLAIAAAFGGFVATGLNAHLDNRADAAPLPAVLPTAA
FT                   ALPASVAGQAVPSLAPMLEKAMPAVVSVNTKQVVRVRNPFFNDPFFRRLFPDIPQERIN
FT                   ESLGSGVIIDAKEGLVLTNHHVIDNADDVQVTLADGRTVKAEFLGSDRDTDIALIRIPA
FT                   QNLTDIKLGNSDQLRVGDFVVAIGNPFGFSQTVTSGIVSAVGRSGIRGLGYQNFIQTDA
FT                   SINPGNSGGALVDLQGQLVGINTASFNPQGSMAGNIGLGLAIPSNLARSVVDQLVKHGV
FT                   VVRGTLGVESQNLTAQIAQGLGLGETRGALVTRVLAGSAAAAAGLKPGDVVVSANGQRV
FT                   DSAEALHNVEGLATVGSPLTLDVRREGKPLQIKAILKEQARAVTGDSLDPRLGGATFVD
FT                   LPESLRQSGAGGVLVSEVKRGSRAASNGLQQGDIITDATVGEFADLASWRANFQQRPPT
FT                   LVLRVLRNNGQQQGQLVMR"
     MRPLPTLLTL AIAAAFGGFV ATGLNAHLDN RADAAPLPAV LPTAAALPAS VAGQAVPSLA        60
     PMLEKAMPAV VSVNTKQVVR VRNPFFNDPF FRRLFPDIPQ ERINESLGSG VIIDAKEGLV       120
     LTNHHVIDNA DDVQVTLADG RTVKAEFLGS DRDTDIALIR IPAQNLTDIK LGNSDQLRVG       180
     DFVVAIGNPF GFSQTVTSGI VSAVGRSGIR GLGYQNFIQT DASINPGNSG GALVDLQGQL       240
     VGINTASFNP QGSMAGNIGL GLAIPSNLAR SVVDQLVKHG VVVRGTLGVE SQNLTAQIAQ       300
     GLGLGETRGA LVTRVLAGSA AAAAGLKPGD VVVSANGQRV DSAEALHNVE GLATVGSPLT       360
     LDVRREGKPL QIKAILKEQA RAVTGDSLDP RLGGATFVDL PESLRQSGAG GVLVSEVKRG       420
     SRAASNGLQQ GDIITDATVG EFADLASWRA NFQQRPPTLV LRVLRNNGQQ QGQLVMR          477
//

If you have problems or comments...

PBIL Back to PBIL home page