(data stored in ACNUC7421 zone)

EMBL: CP001111.PE269

CP001111.PE269       Location/Qualifiers
FT   CDS             318771..319460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pde:Pden_1723 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49974"
FT                   /db_xref="GOA:B4STD1"
FT                   /db_xref="UniProtKB/TrEMBL:B4STD1"
FT                   /protein_id="ACF49974.1"
FT                   /translation="MRGIDFSSWQGVLSTLAGLVLITLLGVGIRLLVMQTLQQRREREN
FT                   RQINERLRTLMAAYKTLGGSFTGELGVDPSHRRDLRQRQDAEGIAEPRSDRARRIRDAV
FT                   EAALSDILLLGTDEQVRLAARAANELAQGRPVHTHDLVVSLRDFVREALDLAPIPADLQ
FT                   IPPQGPTRPGGASGKGRAEGDAKGGRTGGGGGGGGGMGAGMGGVGLGAGAALGAGHASA
FT                   SDEVDAR"
     MRGIDFSSWQ GVLSTLAGLV LITLLGVGIR LLVMQTLQQR RERENRQINE RLRTLMAAYK        60
     TLGGSFTGEL GVDPSHRRDL RQRQDAEGIA EPRSDRARRI RDAVEAALSD ILLLGTDEQV       120
     RLAARAANEL AQGRPVHTHD LVVSLRDFVR EALDLAPIPA DLQIPPQGPT RPGGASGKGR       180
     AEGDAKGGRT GGGGGGGGGM GAGMGGVGLG AGAALGAGHA SASDEVDAR                   229
//

If you have problems or comments...

PBIL Back to PBIL home page