(data stored in ACNUC7421 zone)

EMBL: CP001111.PE27

CP001111.PE27        Location/Qualifiers
FT   CDS             complement(33597..33989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49732"
FT                   /db_xref="GOA:B4SR31"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR31"
FT                   /protein_id="ACF49732.1"
FT                   /translation="MPGLLKTLFLSIVALIGGVLSLALVSSVASWLPPLVGLSPGDSSV
FT                   QLGWDLAFSVLGGVAGISFATYYAPCWPRSHGFSIWSLIALGCGYAVWTAGADFPLWFV
FT                   ISLLASLPLQLLAGWWFGRRASRDPR"
     MPGLLKTLFL SIVALIGGVL SLALVSSVAS WLPPLVGLSP GDSSVQLGWD LAFSVLGGVA        60
     GISFATYYAP CWPRSHGFSI WSLIALGCGY AVWTAGADFP LWFVISLLAS LPLQLLAGWW       120
     FGRRASRDPR                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page