(data stored in ACNUC7421 zone)

EMBL: CP001111.PE271

CP001111.PE271       Location/Qualifiers
FT   CDS             320118..320690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49976"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR026364"
FT                   /db_xref="UniProtKB/TrEMBL:B4STD3"
FT                   /protein_id="ACF49976.1"
FT                   /translation="MKNSLIALALAAALPFTASAAENLSYNYAEADYAKTDIDAFKADG
FT                   WGVKGSYGFLPNFHAFGDYSRQEIDNTNIKLDQWKIGAGYNVEIAPTTDFVARVAYQKR
FT                   DQKHGLDFNGYSAEAGIRTAFGAHAEVYGMVGYEDFSKKHGINPEGQWYGRLGGQVKLN
FT                   QNWGLNGELKMNRDGDKEYTVGPRFSW"
     MKNSLIALAL AAALPFTASA AENLSYNYAE ADYAKTDIDA FKADGWGVKG SYGFLPNFHA        60
     FGDYSRQEID NTNIKLDQWK IGAGYNVEIA PTTDFVARVA YQKRDQKHGL DFNGYSAEAG       120
     IRTAFGAHAE VYGMVGYEDF SKKHGINPEG QWYGRLGGQV KLNQNWGLNG ELKMNRDGDK       180
     EYTVGPRFSW                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page